KEGG   Tetrapisispora phaffii: TPHA_0I02340Help
Entry
TPHA_0I02340      CDS       T02235                                 

Gene name
TPHA0I02340
Definition
hypothetical protein
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
tpf  Tetrapisispora phaffii
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    TPHA_0I02340 (TPHA0I02340)
Enzymes [BR:tpf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     TPHA_0I02340 (TPHA0I02340)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9:complement(514126..516159)
Genome map
AA seq 677 aa AA seqDB search
MHFPFLDSLLNILLVLILFFTKSSFVKADEIQVPEPLTTNNYKKELSKGLHIVDFYSPYC
SHCKALEPIWNDAYREFYEESQKLNIHFSKVNCIESGDICDMEQITFFPNIRLYGPSGFI
KNYPNEAKRSKESLIQFARESAANKDNFKKTKVKSSSKNISGKELEGLIENMNSKEEGIL
VSFWPSKNMNKSDQETVFEGCESCLTFQRTWSAVSKFAPNKNVEVYHVNCEAYKSFCAKY
GFKHLTERSFSEKDPGVAFILPNNHMKRFWKYCKPLSFEPSTYIDWATRLISNSKVPEIS
IEDILKKENTNVITSLLSNNLETFNTRVTYVKDRNNLALSKESMESISSLDVELLQTNYE
FLDNIEEIFAPVEKMINYNETEGLKKFDRNYINLIKNINLPAYMIWKEGNFIPAIVSADI
ACSESCLLDLLLKKLDQLRYSTYSKLPKTTKEMKKLFSNRHNRYVVLQVIDNNEENESIK
FLGNLSVAACDYFYTYSNYIVDQLMLTDNHIKSLFEKMSTKIELSINEKNDLKSSFDKIE
KQDIDFMFVDIKEDLTFKDRLKLPERPEGYIDGDIIIIDKKRRIFYTKNALGNNLNSLSK
YDLKESLLTLTLPSYSHSKIALDSRMPLNAFHPVICIVGVFLLFFLYKFRRSITKIHLGK
KKQEGIILGNFKGTLKD
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgcatttccccttcctcgacagtctgctgaatatattactggtcctaatattatttttt
actaagtcatcatttgtgaaagcagatgagattcaagttccagaaccattgaccactaat
aattataagaaagagttaagtaaagggttacatatcgttgatttttacagtccttattgt
tctcattgcaaagctttagagccaatttggaacgatgcctatagagagttttatgaggaa
agtcagaaattaaatattcacttttcaaaagtgaattgtattgagagtggggatatatgt
gatatggagcaaattacattttttcctaatatcagattatatggtccctctggttttatt
aaaaattatcctaatgaggcaaaaaggtctaaggagagtctgatacaatttgctagggaa
agtgcagccaataaggataatttcaaaaaaacaaaggttaaaagttcaagtaaaaacatt
tcaggcaaagagttagaaggattgattgaaaatatgaattcaaaagaagaaggaatttta
gtttcattctggccatctaaaaatatgaacaagtctgatcaagaaacagtatttgaagga
tgtgaaagctgcttgaccttccaaaggacatggagtgccgtttccaagtttgctccaaac
aaaaatgttgaagtataccatgtcaattgtgaagcctataaatctttttgcgcaaaatac
ggttttaaacatcttactgaaagaagttttagtgaaaaagatcctggagttgcttttatt
cttccaaataaccatatgaaacgcttttggaaatattgtaaaccattgagtttcgaacct
agcacgtacatcgactgggctacgagattaatatctaatagtaaagttcctgaaatatct
attgaagatatattaaaaaaagaaaatactaatgttattacttcattgttatctaataat
ttggaaacatttaacactcgtgtaacgtatgttaaagataggaacaatttagctttatca
aaagaatctatggaatcaatttcctccttagatgtggaattactgcagactaattatgag
ttcctagataacattgaagaaatatttgctccagttgaaaaaatgataaactataatgaa
acagaaggactaaaaaagtttgataggaattatataaatttgattaaaaacataaattta
cctgcatatatgatatggaaagagggaaatttcattcctgcaatagtttcagcagatatt
gcttgcagtgaaagttgtttattggacctgttattaaaaaagcttgatcagttacgctac
tcaacttattcaaaacttcctaagactactaaagaaatgaaaaaactcttttctaatagg
cataatcgatacgttgtattacaggttatcgataataatgaagagaatgaaagtattaag
tttttaggtaatttgtcagttgctgcatgtgattacttttatacctacagtaactacata
gtggatcaattaatgttaacagataaccatattaagagtctttttgaaaaaatgtcaact
aagattgaattgagtattaatgagaaaaatgatttaaaaagtagctttgataaaattgaa
aaacaagatatcgactttatgtttgttgatatcaaagaagatttgacttttaaagataga
ttaaaattaccggaaaggccagaaggatatattgatggagacataatcattattgataag
aagcgtcgtatattttacacaaaaaatgcattgggtaacaatctaaattccctttcgaaa
tacgacttgaaggaaagcttactcacactaacactaccatcttactcacattcaaagatt
gcattagatagtcgtatgcctctaaatgcatttcatccagttatatgtatagttggtgtt
ttcctactgtttttcttatataagtttagacgttcgattacaaagatccatttagggaaa
aagaagcaagaggggattatattaggtaattttaaaggaactcttaaagattaa

DBGET integrated database retrieval system