KEGG   Tetrapisispora phaffii: TPHA_0I03290Help
Entry
TPHA_0I03290      CDS       T02235                                 

Gene name
TPHA0I03290
Definition
hypothetical protein
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
tpf  Tetrapisispora phaffii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tpf00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9:724313..729004
Genome map
AA seq 1563 aa AA seqDB search
MKGRSQLENTLLLRLDSDGVPIANNTLYGSGVLTLPSLPYKLEYINDDNPIVTLKIMIAA
GSTISRDGLIWTNVPESSNVEFNRDHFRKIIIKSSIHSDCYIDLKLFRPGSFCFYVSYRN
KKNLLKTTKKHYFILGPSLFINDTYLPLNSINCQTIISKWLPKSTSPEDNWQKIFKLIAN
KKYNMIHFTPLQQRGESNSPYSIYDQLMFDPDFFKENQKSVKLLIDDLEKTHNMLSLTDI
VFNHTANNSFWLRKHPESGYNQFTAPHLNAAIELDKALLDFSSRLKSLNYPVDLKNDNDL
LEILDGIKVHVLGQLKLWEYYVINIKETVNEVEAKFDEISITNGDEEDESLNDEILNNLE
NLAAYVRENYNVGNFDNLAERYSHKLNIEKLIILLKKSKKFEKFDEETNTFIINLLDEIN
LPLYRIYDDDVNEILEQLFNRIKYLRISDDGPKLGVITNKSPLTEPYFTRFVGENDGIEY
ALANNGWIWNGNPLIDFASKNSKAYLRREVIVWGDCVKLRYGKEPADSPYLWKRMSDYIT
MNAKIFHGFRIDNCHSTPLHVGEYFLDLARSHNPNLYVVAELFSGSETTDCLFVERLGIS
SLIREAMQASSEDELSNLIHRYGGRPIGSYKFVPMDTFAFSPDLELDEDYCTYSIKDKSI
HCVSEIMIPRVLTCQPPHALFMDCTHDNKMPYEKRTIEDTLPNAALVAFCSSAIGSVYGY
DEIYPELLDLVNEKRKYDLSGSINKNLNDEVGICKIKRKLNAIRKEIAISSIDIEDSEMH
VHHEGQYITFHRTNSKTGKGYYLIVRTKFSDFNEDQMFPSVTLRATKCKFNCAYSLEKVD
TSFSPDNDLLTGVKSKIVELKDFTIHVDADSNSVIELPENFPPGSIAIFETGYVGIDDTL
DHLIRSGALKATSNLNFESLNAVLFRSESEELDVSGNTFGAYNIPNHGKLVYCGLQGWVS
VLRDIMINNDLAHPLSVNLREGHWALDYILERLNLYNDKPGIRDVQAWLAERFDKIKQLP
NFLVPSFFALTIGILYGCCRFKAMLLFPKYIGNANVFVQSLALTSIQMVSEVKSTSIFPN
INVPCMCAGLPHFSTNYMRCWGRDVFISFRGLLLVTGRYETAKQHILGFAKTTKHGLIPN
LLDAGRNPRYNARDAAWFFLQAIQDYITIVPEGHSILSEKVSRRFPLNDKYITYEDPEAF
SYSSSIEEIIYEILSRHAKGIKFREANAGPNLDRVMKDEGFNIEIAVDWSTGLIHGGNQF
NCGTWMDKNGESEKAKSKGVPGTPRDGAAVEINGLLKSTLRFVLKLISEGKFKKTDVTRQ
DGSKISFADWNDLLQENFEKNYYIPLDPKDDNEYNTDSNIVNRRGIYKDLCGSGKPFEDY
QLRPNQFIAMAVAPELFSPEHAMSAIKVADENIRGKLGMRTLDPSDYNYRPYYNNSEDSD
DFATSKGRNYHQGPEWVWCYGYFMRSFHTFNFLANPLSRNETENRPSSYLMQQIYLRLDD
HRKAIIESPWAGLPELTNKDGEFCQDSSPTQAWSSGCILDVLYDVWVAFDSKWYAKQIKQ
NNP
NT seq 4692 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaagatcacagttagaaaacacattgctgttgagattagacagtgatggtgta
ccaattgccaataatacactttatgggagtggtgtattgacattaccatctttaccttat
aaattggaatatattaatgatgataatccaatagtcactttgaaaattatgattgctgct
ggttcaacaatttctagagatggattgatttggacaaacgttcctgaatcttctaatgtc
gaatttaatagagatcactttagaaaaattattattaaatcgtctattcatagcgattgc
tacattgatttaaaattatttagaccaggttctttctgtttttacgtatcttatagaaat
aaaaaaaatctattgaagactacaaagaaacattattttattttaggaccctcattattc
attaacgatacttatttacctttgaattcgataaattgtcaaactatcatttccaaatgg
ttaccaaaaagtacaagtcctgaggataattggcaaaaaatctttaagcttatcgcaaat
aaaaaatataacatgatccatttcacacctttgcaacaaagaggtgaatcaaattcccca
tattcaatttatgatcaattaatgtttgatcctgatttttttaaagaaaaccaaaaatct
gttaagcttttaattgatgatttagaaaaaactcacaatatgttatcattgacagacatt
gtttttaatcatactgctaataattctttttggttaagaaaacatccagaatctggttat
aatcaattcacagcgcctcatttgaatgcagctattgaattggataaagcattgctggat
tttagctcaaggttaaaatcattaaattacccagtagatttgaaaaatgataacgatctt
ttagagattctagacggtattaaagttcatgttcttggtcaactgaaattgtgggaatat
tatgttattaatattaaggaaacagttaatgaagtcgaagctaagtttgatgaaataagt
attactaatggagatgaagaggatgaatcattgaatgacgaaatattaaataatttagag
aacttagccgcttatgttcgtgaaaattataatgttggtaattttgataatctagccgaa
agatattcacataaattaaatattgagaaattaattattctattaaagaaatccaaaaag
ttcgaaaaatttgatgaagaaactaacacttttatcataaatctattagacgaaataaat
ttacccctttataggatttatgatgatgatgtcaatgaaatattagaacaattattcaac
agaattaaatatttaagaatcagtgatgatgggccaaaattaggtgttataacaaataaa
tcaccattaaccgaaccctatttcactagatttgttggtgaaaatgatggaatagaatac
gcgttggctaataatggttggatatggaatggaaatccccttatagactttgcttctaag
aactctaaagcttatttaagaagagaggtgattgtttggggtgattgtgtaaagttaagg
tatggtaaagaaccagcagactctccatatttatggaagagaatgtcagattatattaca
atgaacgcaaagatattccacggttttcgtatcgataattgccattctacacctttacat
gtaggcgaatatttcttagatttagcaagatcacacaatccaaatctttatgttgttgct
gaattattctctggctcagagactacagattgtttatttgttgagcgattaggtatctcg
tctttaattagagaagccatgcaagcttcatcagaagatgaattatcaaatctgattcat
agatatggtggtagaccaattggttcttataagtttgttcctatggatacatttgcattt
tcacctgaccttgaattagacgaagattactgcacatacagtataaaggataagagcata
cattgcgtttcagaaatcatgataccaagagttctaacttgccaacctccacatgcctta
tttatggactgtactcatgacaataaaatgccatatgaaaagagaacaattgaggatacg
ttaccaaatgcggcattagttgcgttttgttcaagtgcaattgggtcagtatatggttac
gatgaaatttatccagagctacttgacctagtaaatgaaaaaaggaaatatgatttatct
ggatctattaataaaaatttaaatgacgaggtaggaatctgtaaaataaaaaggaaatta
aacgctatcagaaaagaaattgctattagtagcatcgatattgaagattctgaaatgcat
gtgcatcatgaaggccagtatataacttttcacagaactaattcaaaaacaggaaaaggt
tattatctaattgtaagaacaaaattcagtgatttcaatgaagaccaaatgttcccatct
gttacgttgagagcaaccaagtgtaaatttaattgtgcctattctttagaaaaagtagat
acttcattttctccagataatgatctactaacaggagttaaatcaaaaattgtagaatta
aaagattttacaattcatgtggatgctgacagtaattctgttatagagttacctgaaaac
tttccgccaggttcaatcgcaatttttgaaacaggctacgtggggattgatgatacgtta
gatcatttgattagatcaggagctcttaaagctacttcaaacctaaattttgagtctcta
aatgcagtactttttagatcagaaagtgaagaactagatgttagtggcaacacttttggt
gcttataatattccaaatcatggtaagttggtttattgtggtttacaaggctgggtttca
gtactaagagatataatgataaacaatgacttagcacatcctctaagtgtaaacttacgc
gaaggccattgggccttagattatattttagaacgcttaaatctttacaacgataagcca
ggaattagagatgtccaagcttggttagctgagcgttttgataaaattaaacaattacca
aactttttagttccaagcttttttgctttgactattggtattctttacggttgttgcaga
tttaaagcgatgctattatttcctaaatatattggtaacgcaaatgtatttgtacaaagt
ttggctctaacttcgatccaaatggtttcagaagtaaagtctacatcgatttttccaaat
attaatgtcccttgtatgtgtgccggattaccacactttagcactaattatatgagatgt
tggggcagagatgtatttatttctttcagagggctcttgctagtaaccggaagatatgaa
actgctaaacaacatattctaggttttgctaaaactactaaacatggattgattccaaat
ttattagatgctgggagaaacccaagatacaatgctagagatgcggcatggttcttttta
caagcaatccaagattacattactatagttcctgaaggacattcgattttaagcgaaaaa
gtaagtagaagatttccattaaatgacaaatacattacctacgaggaccctgaggcgttt
agctactcgtcttcaattgaagaaataatttatgaaatcctaagtagacatgctaaggga
ataaaatttagagaagcaaatgctggacctaatttggatagggtgatgaaggatgaaggt
tttaatatagagatcgcagttgactggagtactggtttaatccatggtggcaatcaattt
aactgtggtacttggatggataaaaacggtgaaagtgaaaaggccaaatccaaaggtgtc
ccgggaaccccaagagatggcgctgctgttgaaatcaatggtttattgaaaagtacatta
aggtttgttttgaaattaataagtgaagggaaatttaagaaaacagatgtcaccagacaa
gatggatctaaaatctcctttgcagattggaatgatttgcttcaagaaaattttgaaaaa
aattactatatcccattagatcctaaagatgataatgaatacaatactgattcgaatatt
gtaaacagaagaggcatttataaagacctttgtggttctggtaagccatttgaggactat
caactgagaccaaatcaatttattgctatggcagtggctccagaactattctcaccagaa
catgctatgtctgctataaaagtagccgatgaaaatattagaggcaaactaggaatgcgt
actttggatccaagtgattataattacagaccatattacaacaatagtgaagattctgat
gattttgcaacttctaaaggtagaaattatcaccagggtccagaatgggtatggtgttac
ggttatttcatgagatctttccatacttttaactttttagctaatccattgtctagaaat
gaaactgaaaaccggccatcttcatatttaatgcaacagatttacttaagactagatgat
catagaaaggcaataatagaaagtccatgggcaggtttaccagaattaacaaataaagat
ggggaattttgtcaagattcaagccccacccaagcttggagttcaggatgtattttagat
gtcctatacgatgtttgggtagcttttgattctaaatggtacgcaaaacaaattaaacaa
aacaatccataa

DBGET integrated database retrieval system