KEGG   Tetrapisispora phaffii: TPHA_0J00210Help
Entry
TPHA_0J00210      CDS       T02235                                 

Gene name
TPHA0J00210
Definition
(RefSeq) hypothetical protein
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
tpf  Tetrapisispora phaffii
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    TPHA_0J00210 (TPHA0J00210)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    TPHA_0J00210 (TPHA0J00210)
Enzymes [BR:tpf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     TPHA_0J00210 (TPHA0J00210)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10:complement(48745..51402)
Genome map
AA seq 885 aa AA seqDB search
MVVKFQNVQNENLDDMLGDFRNGEDETIYEGENMDIDNISGSCLGYSDTNVSSVGTSNIS
LTTLSKGLRNLARKTSDIVLLNNNNDDQSYVGPLTTPRAISIAFQYEPSNLLISNELSIE
CEKFRNGIPMMKITRNKSKMRTLRLNGLESITWKDGKKKMDIDTIKDIRIGNLARNYREE
YEISNEFAKFWITVIYEVSNKLKALHVIANNSEDFNTVYACIRGLVKHRSEFMESMALPG
NEKFAKVHWHSTVSFKREDEEVDVLSFEDVEKLCLKFHIYFPSSHLLKVFKAADLNNNGL
LNFQEFQIFVKLLKKREEIDKLWKSITKDDGQYLDLRRFKHFLLNIQKENFTEEYINLLY
SKLCNPTVTKITKANFLKYLSTAPYLKEIEEDYSKPINHYFIASSHNTYLLGKQYGETPS
VEGYIQALQHGCRCVEIDIWDDESGPVVCHGFLTSAIPLINVVNVIRKYAFITSPYPLII
SLEVNCNNQNQIKVASIFNEILGDSLVYENEFELGLLSPEKLKHKIIVKVKKTKNIQDIK
DASTIEASNSHAGSFYDTDESLYEVERDTSSMQSSESMVSQSSSSSIKTRIKRLKMIRET
EIHKELLGICGIHGLKFRNLSLPESKSLTHCFSFNEKKYLNLCTDESLKLSFNKHNRKYL
TRVYPHAFRYKSSNFNPVFFWESGVQMVATNWQTNDYGQQLNKAFFQLSDEKNSQLHSGY
KLKPPHLISIVSKTMEISHIPNDYKPKPLHIKLDIVSAQLLHKPKELYSKDVVLSPYVVV
EFICEENCIDSLTSRNATILAKNKAQTNSCKGNGFNPIWESRLNALLHNSYFAFIKFTVK
TSSVVLAECCLKLDTVKQGYRHIPLYNTKGEKFIFSTLFIRLYTT
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atggtagtgaagttccagaacgtgcaaaatgaaaacttagatgatatgctaggggacttc
aggaatggtgaagatgagacgatatatgaaggtgagaacatggatattgataatattagt
ggaagttgcctaggttactcggatacaaatgtctccagcgttggaacatccaatatatcg
ctcaccaccttgtcgaaaggattacgaaacttggctagaaagacatcagatatcgttttg
ttgaataataataacgatgatcaatcgtatgtgggtcccttgactactcctagggcgatc
agcatagctttccaatacgaaccaagcaatttgttgatctcaaacgaattgagcattgaa
tgtgagaagtttcgcaatggtattccaatgatgaagataactcgtaacaaaagtaaaatg
aggactctgagattaaatggactagaatcgattacttggaaagatggtaagaagaaaatg
gacatagatacgatcaaagatattcgaattggtaacttggcaagaaactatagagaagag
tatgaaatatcaaatgaatttgcaaaattttggattaccgtgatatatgaagtttcaaac
aaactgaaagctcttcatgttatagcaaataactcagaagatttcaatacagtttatgcg
tgtattcgtggactagtgaaacataggtccgaattcatggaaagtatggcgcttcctggt
aacgagaagtttgctaaagttcattggcactcaaccgtatcattcaaaagagaagatgag
gaagtggatgtactatcttttgaagatgtggaaaaactatgtctaaagtttcatatttat
tttccttccagtcatttattgaaagtctttaaagctgctgatttaaataataatggtcta
ttaaatttccaagaatttcaaatattcgttaaattattaaagaaaagagaagaaattgat
aaactatggaaatctattacaaaggatgatggacagtaccttgatcttcggcgatttaaa
cattttctattaaatattcaaaaagaaaattttactgaggaatatatcaacttactatat
tctaagttgtgtaatcctacagttactaaaattacaaaagcaaatttccttaaatatctg
tcaactgcgccatatttaaaggaaattgaggaagattactcgaagccaataaatcattac
tttattgcttcttcgcataatacatatctgttaggtaagcaatatggtgaaacaccatcg
gtggaaggatacatacaagcactgcagcatggatgtaggtgtgtagaaattgatatttgg
gatgacgagtctggacctgttgtctgtcatgggtttttaacatctgctattccattgatt
aacgttgtaaacgtaatcagaaaatatgcgttcattacctccccatatccgctaataatt
tcacttgaggttaattgtaacaatcaaaatcaaataaaagttgcttctatcttcaatgaa
attttaggtgatagtttagtttatgaaaatgaatttgaacttggtttactttcgccagaa
aaactgaaacataaaatcattgtaaaagttaaaaaaactaaaaatatacaagatatcaaa
gatgcttctacgattgaggcatctaattcgcatgcaggatcattttacgatacagatgaa
tctctttatgaagtcgaacgcgatactagttcaatgcaatcttcagaaagtatggtgtca
cagtcgagctcatctagtataaagacaagaatcaagagactgaaaatgattcgagagacc
gaaattcataaagagctgcttggtatttgtggaatacatggcttaaaatttagaaattta
tctcttccagaatctaaatcattaactcactgcttctcttttaacgaaaagaagtattta
aacctatgcacagatgaatctcttaaattatcttttaataagcataataggaaatattta
actcgggtgtatccacatgcctttagatacaaatcgtcgaattttaaccctgtatttttc
tgggagtctggtgttcaaatggtagctactaattggcaaaccaatgactatgggcaacaa
ttgaataaagctttctttcaactttcagatgaaaaaaactcgcaattgcattcaggatat
aagttaaaaccaccccatttgatatctatagtctctaagacaatggagatatcacatatc
cctaatgattataaaccaaaacctttgcacattaagttagatatagtatcagcacaactt
cttcataaaccaaaggaactgtattcaaaagatgttgttctatcgccatacgtggttgtt
gaatttatttgcgaagagaattgcattgattcattaacctctagaaatgctacaattttg
gccaaaaataaagctcagacaaactcctgtaaaggtaatggatttaacccaatttgggag
tctcgtttaaatgcattactgcacaacagttatttcgcatttattaaattcacagtgaaa
acaagttcagtagtacttgctgagtgttgtttaaaacttgacacagtgaaacaaggatac
aggcatatcccattatataatactaaaggtgaaaaatttatcttctcaacattatttatt
cgtttatatacaacctaa

DBGET integrated database retrieval system