KEGG   Tetrapisispora phaffii: TPHA_0J00500Help
Entry
TPHA_0J00500      CDS       T02235                                 

Gene name
TPHA0J00500
Definition
hypothetical protein
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
tpf  Tetrapisispora phaffii
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    TPHA_0J00500 (TPHA0J00500)
Enzymes [BR:tpf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     TPHA_0J00500 (TPHA0J00500)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10:complement(111187..113166)
Genome map
AA seq 659 aa AA seqDB search
MQLQHLALAFAVATSVHGWSPSNGYAPGNVTCDSDVNFLRSGDELSTDEQDWLKKRNDVT
KESLQSFLKRATANFTDTSIFDDLFRSNSSASVPKIGIAASGGGYRAMLSGAGMIAAMDN
RTEGANDVGLGGLLQSSTYLAGLSGGNWLVGTLAWNNWTSVQTIVNNFTEDDAIWDISHS
IVTPGGINIFKSLGRWDDISDAVHDKQDVGFNISLTDVWGRALSYNFFPSLHHGGDAYTW
STLRDVDVFKNAEMPFPISVADGRYPGTTIINSNATIFEFNPFEMGSWDPTLNAFTDVKY
LGTNVTNGTPVVEGQCIEGFDNTGFIMGTSSSLFNQFLLQINSTSIPSFLKSLFTDYLND
LAEDSNDISIYAPNPFKDSSFIKSNYSNSLSTADDLYLVDGGEDLQNVPLLPLIQQKRNV
DVIFALDNSADTENSWPNGTSLVATYERQFVKQGNGTAFPYVPDVDTFVNLGLNKKPTFF
GCDASNMTDLAYIPPLIVYIPNSQYSFNSNQSTFKLSYSTSERLSMIENGFEAATRGNLT
ESSDFLGCVACAIVRRQQESTNATLPAECETCFSNYCWDGTISSNHTAAVAEDDDLSDTA
FSSTSSRKSSKTSSSSSSSRSSSSLSSTVKHSGGVQALSTVDLKSLITVGLFSAIAWLF
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgcaattgcaacacctggctttagcttttgctgttgctacctctgtgcatggttggtcg
ccaagcaatgggtatgctccaggcaatgtcacttgtgactctgacgtgaactttttaaga
tctggtgacgagttatccacagatgaacaagattggttgaaaaagagaaatgacgttacc
aaggagagcttgcagagcttcttaaagagggccactgctaacttcacagacacttctatt
ttcgatgatttgttcagatctaacagcagtgcaagtgtaccaaagattggtatcgccgcc
tcaggtggtggttatagagccatgttgagtggtgctggtatgattgcagctatggataac
aggacagaaggtgccaatgatgtcggtttaggtggtctgctacaaagttctacttactta
gccggtttgtctggtggtaattggttagttggtactctggcttggaataactggacgtcc
gttcagactattgtcaataatttcaccgaagatgatgctatttgggatatttctcatagt
attgtcaccccaggtggtataaacattttcaaaagtctaggcagatgggatgatatctcc
gatgcagtgcatgacaagcaagatgttggcttcaacatctctctaacagatgtttggggt
cgtgctctatcctacaatttcttcccatcattacatcacggtggtgatgcttacacttgg
tctactctaagagatgttgacgtattcaagaatgctgaaatgccattcccaatctctgtc
gctgatggtagatatccaggtaccactattattaactccaatgccaccattttcgaattc
aacccattcgaaatgggttcatgggacccaaccttaaatgcttttactgacgtcaaatat
ttaggtaccaatgttaccaatggtactccagttgttgaaggtcaatgtattgaaggtttc
gataacacaggttttattatgggtacttcttcctctttgttcaaccaattcttactccaa
atcaacagcacctctattccatccttcttaaaaagtctatttaccgattacttaaacgat
ctagctgaggactctaatgacatttctatttatgctccaaatccattcaaagactcctct
tttattaaaagcaactactctaacagtctatctactgctgatgatttgtacttagttgat
ggtggtgaagatttacaaaatgttccattacttccattaattcaacagaagcgtaatgtt
gatgtgatttttgctttagataactcagctgatactgagaactcttggccaaacggtact
tcgttagttgctacttatgagcgtcaattcgttaaacaaggtaatggtacagccttccca
tacgttccagatgtcgacacttttgttaacttgggtttaaacaagaaacctactttcttc
ggttgtgatgcttccaatatgaccgacttagcttacattccaccattgattgtttacatt
ccaaattctcaatattctttcaacagtaaccaaagtactttcaaattgtcttactcaact
tctgaacgtttaagtatgattgaaaatggttttgaagctgctaccagaggtaacttaact
gagagttctgacttcttaggttgtgttgcttgtgccattgttagacgtcagcaagaaagt
acgaatgctactttgccagcagaatgtgaaacctgtttcagtaactactgttgggatggt
actattagctccaaccatactgctgctgttgctgaagatgatgatttatcggacactgca
tttagctccacctcatctcgtaaatcttcaaagacttcttcttcttcttcttcttctcgt
tcttcatcttctttatcttccactgttaaacatagtggtggtgttcaagctttgtcgact
gttgacttaaagtctttaatcactgtaggtttattctctgcaatcgcttggttattctaa

DBGET integrated database retrieval system