KEGG   Tetrapisispora phaffii: TPHA_0J00530Help
Entry
TPHA_0J00530      CDS       T02235                                 

Gene name
TPHA0J00530
Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
tpf  Tetrapisispora phaffii
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:tpf00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10:120581..122350
Genome map
AA seq 589 aa AA seqDB search
MAGSRLDSYRRQNVTTIGLISEDGIVLKSQEHARTTDATTCSAICSPCISLCNAGNTGSS
HYLDEPPYFGSLRHVSGNAIIPYGRIINVTQAAGNPLDPFIDSVNQTISEEEQQTLIHSS
GSISITYIAQKNGIFVPETIPVRIDESIPTPTAAAAGGASTFLDTEEEDCTPTSSSNSQQ
DKTPLINAILKRSYQNAKMYRRILVIVNPHGGKGNAKKIYLSKCEPILKASTATVDIAYT
KYAGHAIDIAREVDLSKYDTIACASGDGIPYEVINGLNQRSDRVDAFNKLAVTQIPCGSG
NAMSVSCHWTTDPSLATLCVLKGNEARIDLMACSQISYADISPKLSFLSQTYGVIAESDI
NTEFIRWMGPSRFDIGVAFNVFQRKKYPCEIYVKYAAEDKESVRVHFEQNKDSTALVFEE
TTCQLSSSSTSLQTKANSIPKTLTDEDFELKYPLNKGVPTDWIKIDEDFTNNIGIFYTGK
MPYIAPATNFFPAALPSDGAIDLIMTDARTPVSKTASILLSLDKGAHVLDENVVHTKILA
YKIIPKLNGSLFSVDGEKFPLEPLQVEVMPQLCKTILRNGRFVDSKFLS
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atggctggttccagattggattcatatcgcagacaaaacgtcaccaccattggtctaatt
tccgaagacggaattgttcttaaatctcaagaacatgcacgtacaacagatgcaacaacg
tgttcggcaatatgttcaccatgcatatcattatgcaatgcaggaaataccggatcgtcg
cactatttagacgagcccccttattttggttctcttagacatgtttcgggaaacgcaatc
ataccatatggccgtattattaatgttacacaagctgctggcaatccgttggacccattt
attgattccgtaaaccagacaatctcagaagaggagcaacagacattaatacattcttcc
gggtctatttcaatcacgtacatagcgcaaaagaatgggatttttgtccccgagaccata
cccgtacgaatcgacgagtccatcccaacgccaacggcagcagcagcaggaggtgcaagc
acattcttagatacagaagaagaagattgcaccccgacgtcatcttcaaattcacaacaa
gataagactcccctaattaatgctatcttgaaaagaagttatcagaatgctaagatgtat
agacgcatactagtgattgtcaatccccatggtggcaaaggtaacgcgaaaaaaatatat
ttatctaaatgtgagccgatcttgaaggcaagtacagcaaccgtcgacattgcatacaca
aaatacgcaggtcatgcaatcgatatagcgcgtgaggtggatttatcgaaatacgatacc
attgcttgtgcctcgggtgacggtattccatatgaagtgatcaatggcctcaaccagaga
tccgatcgtgttgacgcctttaataaactggcagtgacacaaataccttgtggttccggt
aacgcaatgagtgtgtcgtgccattggacaacggatccatcgttggctacactatgtgta
ttgaaaggtaacgaagcacgtatagatctaatggcatgttcacagatatcgtatgcggac
atttcgccaaaattgtcgtttctaagtcaaacgtacggtgtgattgctgaatcagacatc
aatacagaattcattagatggatgggtccttccagattcgatatcggtgtggcattcaac
gtcttccagagaaagaagtatccgtgtgaaatttacgtgaaatatgctgcagaagataaa
gagtccgttagagttcatttcgaacaaaataaagacagcactgccctagtcttcgaggag
acgacatgccaactgtcttcgtcgtcaacctcgttgcaaacgaaagctaactcgattccg
aagactctaacagacgaagatttcgaattaaaataccctttgaacaaaggtgttccgacc
gattggatcaaaatagacgaggattttacaaacaatataggtattttctacacaggtaaa
atgccatatattgctcccgccacgaacttctttcccgctgcattgccttcagatggtgca
atcgacttgattatgacagatgcaagaactcccgtctctaaaacggcatccattttgctg
tcgctagataaaggagcacacgtattagatgaaaatgttgtgcatacaaagatccttgcc
tataaaattattccgaaactcaatggaagtttgttttccgttgatggtgaaaaattccca
ttagaacctctgcaagtggaagtaatgccacaattatgtaagacaatattaaggaatggt
agatttgtggattcgaaattcctatcctaa

DBGET integrated database retrieval system