KEGG   Tetrapisispora phaffii: TPHA_0J00630Help
Entry
TPHA_0J00630      CDS       T02235                                 

Gene name
TPHA0J00630
Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
tpf  Tetrapisispora phaffii
Brite
Enzymes [BR:tpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     TPHA_0J00630 (TPHA0J00630)
Protein kinases [BR:tpf01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   TPHA_0J00630 (TPHA0J00630)
Exosome [BR:tpf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TPHA_0J00630 (TPHA0J00630)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10:139476..140600
Genome map
AA seq 374 aa AA seqDB search
MSRTITFDIPTYYQLVDLIGEGAYGIVCSAVHKPSKTKVAIKKIQPFSKKLFITRTLREL
KLMRYFNNHENIISVLDKVKPVSFDKLNAVYIVQELMETDLHKVVTNNNLKNTSLSDDHI
QYFIYQILRALKSIHSAQVIHRDLKPSNILLNSNCDLKICDFGLSRCLASSNNSKATLVG
FMTEYVATRWYRAPEIMLTFQEYTTAMDIWSCGCILAEMVSGKPLFPGRDYHHQLWLILD
VLGTQSYEDFVQIKSKRAKEYISSLPYSNKMSWDKILGKDMDSLNPQMLDLLDKMLTFNP
NKRISAEEALEHPYMATYHDPNDEPTYEPLNQENDSFWKLDNDMKNVSYEDENEELSMES
LKQMLYAELLTPLD
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtactattacttttgatattcctacttattaccagttggtagatcttattggt
gaaggtgcatacgggattgtatgctctgctgtccataagccttctaagaccaaagtggca
atcaagaaaatacagccgttcagtaagaaactgttcattaccaggacgttacgtgaattg
aagttaatgagatatttcaataaccatgaaaatattattagcgtcttagataaagttaaa
ccagtgagttttgataaattgaatgcagtttatattgtgcaagagttaatggaaactgat
ttacataaagttgtaacgaataacaatctgaaaaatacttcattaagtgatgatcatatc
cagtatttcatatatcagatattacgtgctttaaaatctattcatagtgcacaggtaata
cacagagatttgaaaccttcaaatatactattaaactccaattgtgatttgaaaatttgt
gattttggattatctaggtgtttggcaagtagtaacaattcaaaagcaaccttagttggg
ttcatgacagaatatgtagcaacaagatggtatcgtgctccagaaatcatgctaactttc
caagaatataccactgcaatggatatatggtcatgtggttgtatactagcagaaatggtt
tcggggaagcctttgtttcccggaagagactaccatcatcaactttggttgatattggat
gtcctagggacacaatcatatgaagattttgtacagataaaatcaaaacgggcgaaagaa
tatatatcaagcttaccatatagcaacaaaatgtcatgggataaaattttggggaaagat
atggattcattaaatccacaaatgttagatcttctggataagatgttaacgttcaaccca
aacaaaagaatatctgcagaggaagcattagaacatccatatatggcaacttaccatgat
ccaaatgatgaaccaacatacgaaccattgaatcaagagaatgattcgttttggaaattg
gacaatgacatgaaaaatgtatcttatgaagatgaaaatgaagagttatcaatggaatca
ttgaaacaaatgctatatgcagaacttctcactccactagattga

DBGET integrated database retrieval system