KEGG   Tetrapisispora phaffii: TPHA_0J00750Help
Entry
TPHA_0J00750      CDS       T02235                                 

Gene name
TPHA0J00750
Definition
hypothetical protein
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
tpf  Tetrapisispora phaffii
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TPHA_0J00750 (TPHA0J00750)
   01210 2-Oxocarboxylic acid metabolism
    TPHA_0J00750 (TPHA0J00750)
   01230 Biosynthesis of amino acids
    TPHA_0J00750 (TPHA0J00750)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TPHA_0J00750 (TPHA0J00750)
Enzymes [BR:tpf01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     TPHA_0J00750 (TPHA0J00750)
Amino acid related enzymes [BR:tpf01007]
 Aminotransferase (transaminase)
  Class I
   TPHA_0J00750 (TPHA0J00750)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10:complement(176561..178129)
Genome map
AA seq 522 aa AA seqDB search
MMLRSRSTNCTVNAAIALSGKRLLSLTTISLKHKNFKPADKLTINDLNENVLKAKYAVRG
KIPARAEVLKQQLIDNPSSLPFKKVINANIGNPQQLNQKPLTFYRQVLSLLQYPMVLDET
FSGNTKTLYKQDAIERAKRILNDIGSSVGSYSSSQGVFGLRKTVAEYISRRDGGEKAYAE
DIFLTAGASSAVSYLLNILCKGKESGVLIPIPQYPLYTATLALNNTNALPYYLEENSGWS
TNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEV
YQENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGVSGECGQRGGYMELTGF
STEIKHEILKLCSISLCPVVTGQALVDLMTCPPKKGEASYEQDQMERSTIHSELYERATY
LWKAFNEMEGVSCQKPQGSMYLFPKIDIPHKALEKAQELDITPDELYCAELLEATGICTV
PGSGFGQKPGTFHLRTTFLAPGTSWIDQWREFHQIFCNKYRD
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgatgctaagaagtagatctacaaattgcacagttaacgcagccattgcattatcaggc
aagaggttgctaagtttaacaacaatttctttgaaacataaaaattttaaaccagctgat
aaattgactatcaatgatttaaatgaaaatgttttgaaagccaaatatgctgttagaggt
aaaatcccagctagagctgaagtattgaagcaacaattaattgataatccttctagttta
ccatttaaaaaagttatcaatgctaacattggtaatccccagcagttaaatcaaaaacct
ttgactttttatagacaagtgctatcattgttgcaatacccaatggttttagacgaaact
ttctcaggcaataccaaaacattgtacaagcaggatgcaattgaaagagctaagcgtata
ttaaatgacattggcagttctgttggttcttactctagctcccaaggtgtttttggtcta
agaaaaactgttgctgaatacatatcaagaagagatggtggtgaaaaggcatacgcagaa
gatatctttttaactgctggtgcttcatcggctgtttcatatttgttaaacattttatgt
aagggtaaagaatcaggtgtactcattccaattccacaatatcctttatatacagctact
ttggcattgaataataccaatgcattgccttactatttggaagaaaattcaggatggtca
actaatatggaagaaattgaaaacgttgttcacaatgccattcgtgaaaaaattattcca
agagttttagttgttattaatccaggtaatccaactggtgctattctatcggtggaatcg
attgaaaagatttttgatgttgcagctcatcacggtatagtggttattgcagatgaagtt
tatcaagaaaatatattcccagggaatgaatttcattcgatgaaaaaggtcttaagagat
cttcaaagaagagtgccaggtaaatatgaaaatgtccagttagcttctttgcattcgacc
tctaaaggtgtttctggtgaatgtggtcaaagaggtggttacatggaattgactggattt
tctactgaaattaaacatgaaattttaaaattatgttcaatttcattatgcccagttgtt
actggtcaagcccttgttgatttgatgacttgtcctcctaagaaaggtgaagcctcttat
gaacaagatcaaatggaaagatctacaattcacagtgagttatatgaaagagcgacttat
ttatggaaggcatttaatgagatggaaggtgtatcatgccaaaagccacagggttcaatg
tatttattcccaaaaattgatattccacataaagctttggaaaaggcacaagaacttgac
atcacaccagatgaattatactgtgctgaattattagaagcaactggtatttgtacagtt
ccaggatctggttttggtcaaaaacctggtactttccatttaagaaccactttcttggcg
ccaggaactagttggatcgatcaatggagagagttccaccaaatattttgtaataagtac
cgtgattga

DBGET integrated database retrieval system