KEGG   Tetrapisispora phaffii: TPHA_0J00910Help
Entry
TPHA_0J00910      CDS       T02235                                 

Gene name
TPHA0J00910
Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
tpf  Tetrapisispora phaffii
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TPHA_0J00910 (TPHA0J00910)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TPHA_0J00910 (TPHA0J00910)
Enzymes [BR:tpf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     TPHA_0J00910 (TPHA0J00910)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10:complement(214418..216256)
Genome map
AA seq 612 aa AA seqDB search
MPVSQETLIAQSTSRLSEFDQIQSQLAKEVKDIEKWWSSDRWNNVKRIYTAIDIAKRRGS
FPKTNYQSSIMSKKLFGILKNHHKNGTVSKTFGALDPVQISQMSKYLDTIYVSGWQCSST
ASTSNEPGPDLADYPMDTVPNKVEHLFKAQLFHDRKQFEARANAQSEKELEEMGQPIDYL
TPIVADADAGHGGLTAVFKLTKMFIERGAAGIHIEDQTSTNKKCGHMAGRCVIPVQEHIS
RLTTIRMCSDIMNSDLVLVARTDSEAATLITSTIDKRDHYFVVGATNPEVDEQSYVDYMD
EAISSGNYSNEELAQVEKKWIEKADLKLFHEAFADEVNRNDTISNKSELIEKFNSEIGPL
TGHSNKAAKQLAKQLLGYDIYFNWDIPRVREGLYRYRGGTQCAVMRARAFAPYADLVWME
SNYPDYQQAVEFSEGVRAEFPDQMMAYNLSPSFNWQKAMSTDEQETFIDRLGKQGYCWQF
ITLAGLHTSALTTFEFTKAFHETGMKAYANAVQQREMDLGVDVLKHQKWSGAEYIDGLLK
LAQGGITATASMGKGVTEEQFKKDLEIYNLSAMLMYIIFYTLYQSSIMFLNNFCFISLFF
ILKLINCFYLFY
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtaagtcaagaaacactcattgctcaatcgacttctcgattgagcgaattcgat
caaattcaatcacagctggcaaaagaagtgaaagatattgaaaaatggtggtcatcagat
cgttggaataacgtgaaaagaatttatacagcaatagatattgctaagagacgtggtagt
ttcccaaagacaaattatcaatcttcaattatgtccaaaaaattatttggaattctaaaa
aatcatcataaaaatggtacggtctctaaaacttttggagctctagatcctgttcaaatt
tctcaaatgtcgaaatatttagatactatttatgtttcaggttggcaatgttcttcaacg
gcttccacatcaaacgaacctggtcctgatttagccgattatccaatggatacagtacca
aataaagtagaacatttatttaaagctcaattatttcatgataggaaacagttcgaagca
agagcaaatgctcaatcagagaaagaattagaagaaatgggacagccaattgattatcta
acgccaatcgtcgcagatgcagatgcaggtcatggtggtttgactgctgttttcaaatta
acaaaaatgtttattgaaagaggtgccgcaggtattcatattgaagatcaaacttcaaca
aataaaaagtgtgggcatatggcagggagatgtgtgattcctgttcaagaacatatctca
agattgaccactatcagaatgtgttcagatatcatgaactctgatctagttttagtggca
agaactgattctgaagcagccactctaattacttcaacaattgacaaaagagaccattat
tttgttgtcggggcaactaacccagaagttgatgaacaatcttatgtagattacatggat
gaagcaatttcttctggtaattattcaaatgaagagttagcacaagtggaaaaaaaatgg
attgaaaaagctgatttgaagctattccatgaagcttttgcagacgaagttaatagaaat
gatacaatctcaaataaaagcgagctaattgagaagtttaactcagaaattggtccattg
actggccattcaaataaagcagccaaacaattagccaaacaattattaggttatgatata
tacttcaattgggatattccaagagtaagagaaggactttaccgttacagaggaggtact
caatgtgcagtaatgagggctagagcttttgctccatatgcagacttagtatggatggaa
tcaaactatccagattatcaacaagcagttgaattttcagaaggtgtcagggcagaattt
cctgatcaaatgatggcttataatttatctccatcctttaactggcaaaaggcaatgtca
actgatgaacaagaaacattcattgatagactaggtaaacaaggttactgttggcagttc
atcactttggccggtttacatacctcggctctaacaacttttgaattcaccaaagcattc
catgagacaggtatgaaagcttatgctaacgctgttcaacaaagagaaatggatttggga
gtggatgttttaaaacaccaaaaatggtctggtgcagagtacatcgatggattattgaaa
ttggcacaaggcggtattaccgcaacagcgtcaatgggcaaaggtgtcactgaagagcaa
ttcaaaaaagacttagaaatatataatctgtctgcgatgcttatgtacataattttctac
acattatatcaaagctctataatgtttctaaataatttttgttttatttctttatttttt
attctaaaattaataaattgtttttacctattttattaa

DBGET integrated database retrieval system