KEGG   Tetrapisispora phaffii: TPHA_0J02050Help
Entry
TPHA_0J02050      CDS       T02235                                 

Gene name
TPHA0J02050
Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
tpf  Tetrapisispora phaffii
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    TPHA_0J02050 (TPHA0J02050)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    TPHA_0J02050 (TPHA0J02050)
Enzymes [BR:tpf01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     TPHA_0J02050 (TPHA0J02050)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10:458631..459110
Genome map
AA seq 159 aa AA seqDB search
MSFYELTPKDKANQDYPFQQLEGKVVLIVNVASKCGFTPQYKGLEEIYQKYKDQGLVILG
FPCNQFGHQEPGNDEEISSFCSLNYGVTFPVLKKIDVNGANTDPVYDYLKNSKSGLLGFK
GIKWNFEKFLVDKKGNVYQRYSSLTKPTSIEEDIQKLLK
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgtcattctatgaactaactccaaaagacaaagctaaccaagattatcctttccaacaa
cttgaaggtaaagttgtcttaattgtaaatgtcgcttccaagtgtggtttcactcctcaa
tacaagggtttagaagaaatatatcaaaaatacaaggaccaaggtttagtcatcttgggc
ttcccttgtaaccagttcggtcatcaggaaccaggtaacgatgaagaaattagttccttc
tgttcattgaactacggtgtaactttccctgtcttgaagaaaatcgatgttaatggagca
aacacagacccagtttatgactatttgaagaattccaagtctgggctattaggtttcaaa
ggtattaagtggaatttcgaaaaattcttagttgacaagaaaggtaacgtttaccaaaga
tactcttctttgaccaagccaacttccatcgaagaagacatccaaaaattattaaaataa

DBGET integrated database retrieval system