KEGG   Tetrapisispora phaffii: TPHA_0J02620Help
Entry
TPHA_0J02620      CDS       T02235                                 

Gene name
TPHA0J02620
Definition
hypothetical protein
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
tpf  Tetrapisispora phaffii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10:complement(580898..584575)
Genome map
AA seq 1225 aa AA seqDB search
MHSEKGIKTNSNNTHKIHSKDSLYILAKKFKKLGEESKLKKHHHDADKINPNTANSSAQN
VEKNDTSIDDGMHLLYQNIEKEGVFKTSQRILDDILTDIAFMSLDSEKSDDIDFKDGVLN
LPTIKYSLWRKYIKPFKIILFNTNNPVVDVKLQHKSVTSPKNNTITELYGLLVPKIPRRS
ELNTFDEYIRSKPLYSIRITVKTRHRLEHKKKHIALTPYFLLDDFDKLHEVDKSDFPKFN
KDSKDLLDFSIYISSDTNKIILIEIFKPAFNQTELDYLLSSASVLNRSNELDNLHEELQP
DYNDAIVEEQIDTIEILLHCIMQNLKGSPERELEKQKTSFLLSDDVKLGTYVDIKWLEEN
FDIKVKEQKRKDHVSITLDEALKLSFDDPNPKNQAKFDKITRYAMELMYLGKVLQSFYSN
EEEIEEYMEDTIFKQVKVHHTTSFWTQILNEYQSIFSSQKTSTRCVDEHFINLCIDSNVS
EKDIITNYEIQLRTDPDNDSKYFESLKYVSRKFPDYIVLEKYCKENVIISKAAYLHALEI
FKYSEEYFNAIEHVSEIWDKYTELVQSNNNNDDQYRVDLVDSFYSLATVKKSSPLIYITK
YEPFFHPVTAYLKLNVDAKLDSENIVLAYTMQIREVPEHKIQFDRALFAIAIQRHDLSLL
YVLKQNCSAFNECISNIILTSDDAFEIIGMPKTSSELSIINTFTKYWKETDDSNPVNFIL
ASAALREVSKHRASALLRHFYEFGKVNPKMIDSELWPTGINNIGNTCYLNSLLQYYFSIT
LFREFIENYQSIESDLLNSNAEMSKRRVGGREIQNNEINRSVQFIYQVQDLFKLMVHTKS
RKVTPSNQLAYLAFAPNNAEIKFKHKSELESSEEHQLTTSHSIALSSATSISHSDIDTQD
HDISLNSTSYSNRLVAMVTRDDLETTLEIGNQQDVTECINTVLYQVETGSMPLYLDADNE
QMDLVKELFYGETIQEICPIKKFIKGHEKRELYSSLLVNILDSPTDLYEVLDEYFADEYM
SMEEYGEVKKTLSITKLPTILNIQIQRVYYDKEKLVPYKCGTALPFKNEIFLDRYIKGNK
KENDVLEKARLELKLAKVKYRELVSEYNSVNKSISDRIITTYDRIEELNAVIEEEVTKDA
KIRYSLFAVFIHRGQASFGHYWVYIRDFENGIWRKYNDHQVTGAHEDEIFKCVDGDISTP
YFLAYVDSSKKSIVKPLVRDVTRAK
NT seq 3678 nt NT seq  +upstreamnt  +downstreamnt
atgcattcagaaaaagggataaagaccaattccaataatactcacaaaattcattcaaaa
gattccttgtatatattggctaagaaatttaagaagcttggagaagaatcaaaattgaag
aagcatcaccatgatgctgataaaataaatcccaacactgctaactcatcagctcaaaac
gtcgaaaagaatgatacatcaatagatgatgggatgcatttactatatcaaaatatagag
aaagaaggtgtttttaagacctctcagagaatcttagatgatatattaactgatattgca
tttatgtcattagattcggagaagtctgatgacattgattttaaagatggtgtattaaat
ttacccacaattaaatattcattatggaggaaatacatcaaaccattcaaaattatttta
ttcaacaccaataatccagtagttgatgtcaaacttcagcataagtctgtcacatcccca
aagaacaatacaatcacagagttatacggattgttggttcccaaaattccaagacgaagt
gaattaaatacatttgatgaatatattagatcaaaacctctatacagtataagaataacc
gtgaagaccagacatagattagaacataaaaagaaacatattgctttgacgccgtatttc
ctgctggacgattttgataaattacatgaagttgataagagtgacttccctaaatttaat
aaagattcaaaggacttactagatttttcaatatatatatcaagtgatacaaataaaatt
attctaatcgaaatttttaaacctgcgtttaatcagacagagctagattatttactatcg
tcggcatcagtactcaatagatcaaacgaacttgataaccttcacgaagaattgcagcct
gactataacgatgcaatagttgaagagcagatagatacaattgaaatacttctacactgt
ataatgcaaaatttgaaagggtcaccagaaagagagctagagaaacaaaagacgtccttt
cttttatcagatgacgttaagttgggtacttacgttgatataaaatggttggaagagaat
tttgatattaaggttaaggaacagaagagaaaggatcatgtctcaattactttggatgaa
gctttgaaactttcctttgacgaccccaatccaaaaaatcaagcaaagtttgacaaaatt
actaggtatgccatggaacttatgtatctgggaaaggttttacaaagtttttatagtaac
gaagaagaaatagaagaatacatggaagatactatctttaaacaagtaaaagtacatcat
actacttctttttggacacaaatacttaatgaataccaatcaatattttcatcacagaaa
actagtacaagatgtgttgacgagcactttataaacttatgcattgacagtaatgtttcg
gaaaaagatattatcacaaattatgaaattcaattacgaacagatccagataatgacagt
aaatattttgaatcattgaagtatgtttccagaaaatttcccgactatattgtattggag
aagtactgtaaagaaaatgttattatttctaaagctgcttatttacatgcattagagatc
tttaaatactcagaagaatatttcaatgctattgaacatgtttccgaaatttgggataaa
tatactgaattagttcagagtaacaacaacaatgacgatcagtatagagttgacttggtg
gatagtttttattcattggcaacagttaaaaaatctagcccattaatatatattacaaaa
tatgaaccatttttccatccagtgacagcatatttaaagttaaatgtggatgcaaaatta
gacagtgaaaacatagtactagcgtatactatgcaaatacgagaagttcctgaacacaaa
atccaatttgatagagcactatttgccattgccatccagaggcatgatttaagtttactg
tacgtattaaaacaaaattgctcagcattcaatgagtgtatctcgaatattattttaaca
agcgatgatgcgtttgaaataatcgggatgcctaaaactagcagtgaattatcaataatc
aacacatttactaaatattggaaggaaactgatgacagtaacccagtaaactttatactg
gcttctgccgcattaagagaagtttctaaacatagagcatcagctcttttaaggcatttt
tatgagttcgggaaagtgaacccaaagatgatcgattctgaattatggccaactggtatc
aataatataggcaatacatgttacttaaattccttattacaatattatttttcgatcact
ctatttcgtgaatttatagagaattatcaatcaatagaatctgacttattgaatagtaat
gccgagatgagtaaaagaagagtcggcggccgtgagattcagaacaatgagattaaccgt
tcagttcagttcatttatcaagttcaagatttattcaaattaatggtgcacacaaaatcg
aggaaagtgacacccagtaaccaattggcatatttagcatttgctccaaataatgcagag
attaaattcaaacataaatcggagctggaatcctctgaagaacatcaactaactactagt
cattccatcgcattaagtagtgcaacgtccattagtcattcggatattgatacacaggat
catgacattagtttaaacagcacgtcttattccaatagacttgttgcaatggtgactagg
gatgatttggaaactacacttgaaataggtaaccagcaggatgtcacagagtgtatcaat
actgtgttgtatcaggtggagactggatccatgcctctctatctcgatgcagataacgaa
caaatggatttagtgaaagagctattttatggagaaaccatccaggagatttgccctatt
aagaaatttatcaagggacatgaaaagcgagagttatattcttcccttttggtcaatatt
ctagattctccaactgatttatatgaagttttagacgagtacttcgctgacgagtacatg
tcaatggaagaatacggggaagttaagaaaaccttgtcgataacgaaacttcctacgatt
cttaatatccaaatacagagagtgtactatgacaaagagaagctggtaccttataaatgc
gggacagccttgcctttcaagaacgagatatttttagacaggtatattaagggcaacaag
aaagaaaatgacgtccttgagaaggccagactggaattaaaactggcaaaagtaaagtac
cgggagttagtctctgagtataattctgtgaacaagagcataagtgacaggatcatcact
acttatgaccgtattgaagagcttaatgcagtaatcgaagaggaggtcactaaggatgcc
aagatcaggtacagcctttttgcagtattcatccaccgaggccaggcttcatttgggcac
tactgggtctacatccgagattttgagaacgggatctggaggaagtataacgaccaccaa
gtaacgggggcacacgaagacgagatattcaagtgtgtcgatggcgacatctcgacgcca
tactttcttgcatacgtcgattcatccaaaaagagcatcgtgaagccattggtacgggac
gtcacaagggccaagtga

DBGET integrated database retrieval system