KEGG   Tetrapisispora phaffii: TPHA_0K00320Help
Entry
TPHA_0K00320      CDS       T02235                                 

Gene name
TPHA0K00320
Definition
(RefSeq) hypothetical protein
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
tpf  Tetrapisispora phaffii
Pathway
tpf00230  Purine metabolism
tpf01100  Metabolic pathways
Module
tpf_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    TPHA_0K00320 (TPHA0K00320)
Enzymes [BR:tpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     TPHA_0K00320 (TPHA0K00320)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_33 AAA_22 AAA_18 RNA_helicase MMR_HSR1 AAA_28 AAA_24 ABC_tran AAA_29 NACHT AAA DUF2075 RsgA_GTPase AAA_30 T2SSE AAA_14 NTPase_1 dNK KAP_NTPase MobB ATPase_2 AAA_19 cobW Cytidylate_kin Adeno_IVa2 AAA_5 Rad17 AAA_23 Viral_helicase1 Pox_A32
Motif
Other DBs
NCBI-GeneID: 11533373
NCBI-ProteinID: XP_003687600
UniProt: G8BZ38
Position
11:64029..64589
Genome map
AA seq 186 aa AA seqDB search
MPRPIVISGPSGTGKSTLLKKLFAEFPDKFGFSVSSTTRQPRAGEIDGKDYNFSSVEQFQ
GMIADKKFIEWAQFSGNYYGTAIESVEKVIASGKTCILDIDMQGVKAVKASELNARFLFV
APPSVESLRDRLVGRGTETDESLTKRLAAATAELEYAESGAHDKIVVNDDLDRAYTEMKE
FIFSEA
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgccccgtcctatcgttatttctggtccaagtggtactggtaagtccactcttttgaag
aaattatttgctgagttcccagacaaatttggcttctctgtgtcttcgaccaccagacaa
cctcgtgccggtgaaatcgatggcaaagattacaatttcagttctgtcgaacaattccaa
gggatgattgcggacaagaagttcatcgaatgggcgcaattcagtggaaactactacggc
acagccattgagtctgttgaaaaagtgatcgccagtggtaagacatgtattctcgacatc
gatatgcagggtgtcaaagctgtcaaggccagcgaattgaatgcgcgcttcttgtttgtt
gctccgccatctgtcgagtcgttgagagatagactggtcggcagaggcaccgaaaccgac
gaatcgttaaccaaacgtcttgcggcagccactgccgagttagaatacgctgaaagcggc
gcccatgacaaaatagttgtcaacgacgaccttgaccgtgcctacacggagatgaaagaa
ttcatcttctcagaggcctga

DBGET integrated database retrieval system