KEGG   Tetrapisispora phaffii: TPHA_0K00600Help
Entry
TPHA_0K00600      CDS       T02235                                 

Gene name
TPHA0K00600
Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
tpf  Tetrapisispora phaffii
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    TPHA_0K00600 (TPHA0K00600)
  Replication and repair
   03420 Nucleotide excision repair
    TPHA_0K00600 (TPHA0K00600)
Transcription machinery [BR:tpf03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     TPHA_0K00600 (TPHA0K00600)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11:122289..123383
Genome map
AA seq 364 aa AA seqDB search
MSVKQKKKVLEKPEGYKVISDDDLFRSSSQYRLWSFTKEQLDTKRVDTNAHAVAAIEEKL
TMFKKDYASDISEEDAKMINEKAIPLTAEEELKLVDFYAKKVQGIAQHLNLPTEVVSSAL
IFFKRFYLENSVMEIDPKTIVHTIIFLACKSENYFISVDSFSKKTKASRDTILKYEFRIL
ESLKFSLLCHHPFKPLHGFFLDIQNVLHGKVDVKYMGEIYTKTKKRISDALLTDVAFLFT
PPQITLAALSLEDEQLTEKYLETKFSNTDTIIEASKDTNEKDKDSEVIKEDRPDKINYIL
LLSLIDQCKEVMSNPSQVSMEEAKSSAAKLYFCNHPMNIIQRNKKTQPDGTDSKEESPVK
KQKI
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgaagcagaaaaagaaagttttagaaaaacctgaagggtacaaagttatttct
gatgatgatctatttagatcgtcctcacaatatagactatggtccttcacaaaggagcaa
ttggatacaaaaagagtagacacgaatgcccatgcagttgcagctatcgaggagaagtta
acgatgtttaagaaggattatgctagcgatattagcgaagaagatgctaaaatgattaat
gagaaggcaattcctctaaccgcagaagaagagttgaagttagttgacttctacgccaag
aaagtccaaggcattgcgcaacatttgaacctaccaacggaggttgtttcttctgcgttg
atatttttcaaaagattttatttggaaaactctgtaatggagattgatccaaagaccatt
gtccatactatcattttcttagcttgtaaatctgaaaactatttcatcagtgtcgactct
ttctccaagaagaccaaggccagcagagatacaatattaaaatatgaattcaggattcta
gaaagcttgaagttttctttattatgtcaccatccttttaagcctttgcatgggttcttc
ctggatatccaaaatgttttacatggaaaagttgacgtgaaatatatgggagaaatttac
accaagaccaagaaaagaatatccgatgcactattgacagacgtggcatttttattcact
ccaccgcaaatcactcttgctgctctttcgttagaggatgagcaactaacggagaaatat
ttggagactaaattcagcaataccgataccatcatcgaggcaagcaaggataccaatgag
aaagataaagatagcgaggtcataaaagaggacagaccagataaaattaactacatactg
ctactgtcattgatcgatcaatgcaaagaggtcatgtctaatccctcacaagtatcaatg
gaagaggcaaaatccagtgctgcaaagctatacttctgtaatcatccaatgaacataatc
caaagaaataaaaagacgcaacctgatggaacagattcgaaagaggagtccccagttaag
aaacagaaaatataa

  All links  
No link information was found.   
DBGET integrated database retrieval system