KEGG   Tetrapisispora phaffii: TPHA_0K00780Help
Entry
TPHA_0K00780      CDS       T02235                                 

Gene name
TPHA0K00780
Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
tpf  Tetrapisispora phaffii
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    TPHA_0K00780 (TPHA0K00780)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11:163003..164088
Genome map
AA seq 361 aa AA seqDB search
MSFFQQKPAVSSSSTIATDADMANDIVINNPAEDSISDVAFSTQNEFVFSASSWDGKVKI
WNINNGNPQAVAQYSHSAPVLSTRWSGDGTKVASGGCDNIVKLFDLTTNQEQQVGTHDSA
IKNLRFVNCGPTNSQCLVTGSWDKTIKYWDLRQQQPIATLAMPDRVYAMDSSNQLLVVGT
AERHIAVINLTNPGQIYKTIQSPLKMQTRTIACYPSGDGYAIGSIEGRIAIRYLDEEIQK
KSGFSFKCHRKTNPNRSIGASSQTDVFSVNSISFHPIYGTFVSAGSDGTFHFWDKNKKHR
LKGYPAQNGSISAVNFNGKGSLLAYSLGYDWSKGHSFNTQNYANIIRIHAPTDAEVKEKA
R
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtcattttttcaacagaaaccagcagtttctagttcttctaccatagccacagatgct
gatatggctaatgatattgtaattaataatcctgccgaggattcgatatcagatgttgca
ttctcaacccaaaatgagttcgtcttcagtgccagttcttgggacggcaaagtgaagata
tggaatatcaataatggtaacccacaggcagttgcacaatattcccactcagctccagtc
ttgagtactagatggtctggagatgggactaaggtggcatcaggtggctgtgataatatt
gtcaaactttttgatcttactactaatcaagaacaacaagttggtacacatgattcagca
attaaaaatttaagatttgttaattgtggccctacaaatagtcaatgtctagttactggt
tcgtgggataagactatcaaatattgggatttaagacagcaacagccaattgctactctt
gctatgcccgatcgtgtttatgctatggactctagtaaccagctactagttgtcggaact
gcagaaagacatatagcggtaattaacttaacaaacccaggtcaaatatacaaaactata
cagtctccactgaaaatgcaaacaagaacaatcgcatgttatccttcaggtgatggttat
gctattggctccatagagggtagaatagcaatccgatatttagatgaggaaatacaaaag
aaatcaggattttcctttaaatgtcataggaaaaccaatcctaatagaagtattggagct
tccagtcaaactgatgtattctcagttaatagtatttcattccatcctatatatggtaca
tttgtatcagctggtagtgatggtactttccatttctgggataaaaataagaagcataga
ttaaaaggatatcctgcccaaaatggctctatatcagcagtgaattttaatgggaaaggg
agccttttagcctattctttaggttatgattggagcaaagggcatagctttaatactcaa
aattatgctaatatcattagaatccatgctccaacagatgctgaagtcaaggagaaggct
aggtga

DBGET integrated database retrieval system