KEGG   Tetrapisispora phaffii: TPHA_0K00940Help
Entry
TPHA_0K00940      CDS       T02235                                 

Gene name
TPHA0K00940
Definition
hypothetical protein
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
tpf  Tetrapisispora phaffii
Brite
Enzymes [BR:tpf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     TPHA_0K00940 (TPHA0K00940)
    1.3.1.94  polyprenol reductase
     TPHA_0K00940 (TPHA0K00940)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11:192831..193610
Genome map
AA seq 259 aa AA seqDB search
MVNLINFTIIGYRSSFIFGLFSLVIAKWFLPEFLKYGKTLTTRDSSNDIKKVFEDNGTKN
LLERIQNTTVPKQWFFHFYLLSTIFTLITLYKNYQHKIIWIILIHSLRRLYETLYVSKYT
SESRMNWSHYVVGLWFYSVLHIILYIQILQGNIDTHLNYYSVLLFTMASWDQHKNHTILS
ELVKYSLPKGRLFSICSSPHYLDEILIYMSFLPFNREFSWLVVWIIASLTISAIETHNYY
KSKFKDQTIPKYSIIPFII
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggttaacttgatcaatttcactataattggttacagatcatctttcatatttggtcta
ttttcattagtgatagcgaaatggtttttacctgaatttttgaaatatggcaaaacatta
actacaagagattcatctaatgacattaaaaaggtgtttgaagacaacggtaccaagaat
ctattagagcgtatacaaaatactactgtaccgaagcaatggttctttcatttttacttg
ttgtcgacgatattcactctgattactttatataaaaattatcagcataaaattatatgg
atcattcttatccattcgttgagaaggctatatgagactctatatgtttcaaaatatacc
agtgaatcaagaatgaactggtcacattatgttgttggcttgtggttttactcggttctg
catataatcctatatattcaaatcctccaagggaacattgatacacatttgaattattac
agtgtactattatttacaatggcatcatgggatcaacacaagaaccacacaattctgtcg
gaactagttaaatactcgttaccaaaaggccgtctatttagtatttgttcatcaccacat
tatctggatgaaatattgatatacatgtctttccttccattcaatagagaattcagttgg
ttagtagtgtggataatagcaagtctaacaatttctgcaatcgagacgcataattactac
aaatcaaaattcaaagatcaaacaataccaaaatatagtatcattccattcataatataa

DBGET integrated database retrieval system