KEGG   Tetrapisispora phaffii: TPHA_0K01710Help
Entry
TPHA_0K01710      CDS       T02235                                 

Gene name
TPHA0K01710
Definition
(RefSeq) hypothetical protein
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
tpf  Tetrapisispora phaffii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TPHA_0K01710 (TPHA0K01710)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TPHA_0K01710 (TPHA0K01710)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TPHA_0K01710 (TPHA0K01710)
Enzymes [BR:tpf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TPHA_0K01710 (TPHA0K01710)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11:360969..363083
Genome map
AA seq 704 aa AA seqDB search
MSELLRQTFANAKKENRNALVTFMTAGYPTIEDTVPILKGFQDGGVDVIELGLPFSDPIA
DGPTIQVANTVALENGVTMIKALELLRQARSEGITVPIILMGYYNPILNYGEEQFIKDAA
EAGANGFIIVDLPPEEALKVRNYVRENGVSLVPLIAPSTTDERLGLLSHIADSFVYVVSR
MGTTGAQTSISSDLDQLVSRVRKYTKDIPLAVGFGVSTREHFETVGASSDGVVIGSKIVS
LCSEAAQDKRYETAKTYVEGILNGKKHHILSVEEFNEQHKQSLIDAKNSSKVDNEFSEEH
KFPTRFGDFGGQYVPEALHSCLRELERGFEDAVADPTFWEEFRSLYSYIGRPSSLHKAER
LSEHCGGATIWLKREDLNHTGSHKINNALAQVLMAKRLGKSNVIAETGAGQHGVATATAC
AKFGLKCTVFMGAEDCRRQALNVFRMKILGADVVPVTNGTQTLRDATSEAFRTWVTNLKS
TYYVVGSAIGPHPYPTLVRTFQSVIGNETKEQFAKLNNGKLPDAIVACVGGGSNSTGMFS
PFEHDISVRLIGVEAGGDGIDSDYHSATLTVGRPGVFHGVKTYVLQDNDGQVHDTHSVSA
GLDYPGVGPELAFWKASGRAEFMAATDAQALEGFKLLSQLEGIIPALESSHAVYGAIQIA
KKMTPEQHLIINVSGRGDKDVQSVAEVLPKLGPQIGWDLRFEEK
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaattattaagacaaacttttgctaatgcaaagaaggaaaaccgtaatgcttta
gtcacttttatgactgccggttatcctactatcgaggacactgttcctattttaaaaggt
ttccaagacggtggtgtagatgttattgaattgggtttaccgttttctgaccctattgct
gatggtccaactattcaagttgcaaacactgttgctttagaaaatggtgtaactatgata
aaagctttggaattattaagacaagctagaagtgaaggtatcactgttccaattattttg
atgggttactacaatccaatcttgaattatggcgaggaacaattcatcaaagatgctgct
gaagctggtgccaatgggtttatcattgttgatttaccacctgaagaagctttaaaagtt
agaaattacgttagagagaatggtgtcagtttagtgcctctaattgcaccatctactact
gatgaaagattaggtttattatcccacatagctgattcttttgtttacgttgtctcaaga
atgggtactactggtgctcaaacttcaatttcaagtgatctagatcaattggtctctcgt
gttagaaaatataccaaagatattccattagctgtcggttttggtgtttcgaccagagaa
catttcgaaactgtcggtgcatcttctgacggtgttgttattggttctaagattgtttcc
ctatgtagtgaagctgctcaagataaacgatatgaaactgctaagacttatgtagaaggt
atcttaaatggtaaaaaacatcatattctatccgtcgaagaattcaacgaacaacataaa
caatcgttaattgatgcaaagaattcttcgaaagttgataatgagttctctgaagaacat
aaatttccaactagatttggcgatttcggtggtcaatacgtcccagaagctttgcattca
tgtttaagagagttagaaagaggctttgaagatgctgtagctgatccaactttctgggaa
gaatttagatcattatattcgtacattggccgtccttcatctctacataaagccgaaaga
ttatccgaacattgtggtggtgctaccatttggttaaagagagaagatctaaaccacacc
ggttcccataagatcaataatgctttagctcaagttttgatggctaaaagattaggaaag
agcaatgttattgccgaaacaggtgccggtcaacatggtgttgctactgccactgcttgc
gctaagtttggtttgaaatgtaccgtttttatgggtgctgaggattgtcgtcgtcaagca
ttaaacgtctttagaatgaaaattctaggtgctgacgttgtcccagtcactaacggtact
caaactttaagagatgctacatccgaagctttccgtacttgggtaaccaatttaaagtct
acttattacgtcgttggttccgctattggccctcatccatatccaacccttgtacgaacc
tttcaaagtgtcattggtaatgaaaccaaagaacaatttgctaaattgaacaacggaaaa
ttaccagatgctattgttgcatgtgtcggtggtggttctaactctacaggtatgttctct
ccatttgaacatgatatttccgttagattaattggtgttgaagccggtggtgatggtatc
gattctgactatcattccgcaacactaactgttggcagaccaggtgttttccatggtgtc
aaaacttatgttttacaagataacgatggccaagtccatgatacacactctgtttcagct
ggtttagattacccaggtgttggtccagaattagcattctggaaggcttctggtcgtgcc
gaattcatggctgctactgacgcacaagctttagaaggtttcaagttattatctcaacta
gaaggtatcatccctgctttagaatcttctcatgccgtttatggagctatccagattgcc
aagaaaatgactccagaacaacatttaattatcaatgtttctggtagaggtgacaaagat
gttcaaagtgttgccgaagttttacctaaactaggtccacagattggttgggatttaaga
tttgaagaaaaataa

DBGET integrated database retrieval system