KEGG   Tetrapisispora phaffii: TPHA_0K01710Help
Entry
TPHA_0K01710      CDS       T02235                                 

Gene name
TPHA0K01710
Definition
hypothetical protein
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
tpf  Tetrapisispora phaffii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tpf01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:tpf00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:tpf00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11:360969..363083
Genome map
AA seq 704 aa AA seqDB search
MSELLRQTFANAKKENRNALVTFMTAGYPTIEDTVPILKGFQDGGVDVIELGLPFSDPIA
DGPTIQVANTVALENGVTMIKALELLRQARSEGITVPIILMGYYNPILNYGEEQFIKDAA
EAGANGFIIVDLPPEEALKVRNYVRENGVSLVPLIAPSTTDERLGLLSHIADSFVYVVSR
MGTTGAQTSISSDLDQLVSRVRKYTKDIPLAVGFGVSTREHFETVGASSDGVVIGSKIVS
LCSEAAQDKRYETAKTYVEGILNGKKHHILSVEEFNEQHKQSLIDAKNSSKVDNEFSEEH
KFPTRFGDFGGQYVPEALHSCLRELERGFEDAVADPTFWEEFRSLYSYIGRPSSLHKAER
LSEHCGGATIWLKREDLNHTGSHKINNALAQVLMAKRLGKSNVIAETGAGQHGVATATAC
AKFGLKCTVFMGAEDCRRQALNVFRMKILGADVVPVTNGTQTLRDATSEAFRTWVTNLKS
TYYVVGSAIGPHPYPTLVRTFQSVIGNETKEQFAKLNNGKLPDAIVACVGGGSNSTGMFS
PFEHDISVRLIGVEAGGDGIDSDYHSATLTVGRPGVFHGVKTYVLQDNDGQVHDTHSVSA
GLDYPGVGPELAFWKASGRAEFMAATDAQALEGFKLLSQLEGIIPALESSHAVYGAIQIA
KKMTPEQHLIINVSGRGDKDVQSVAEVLPKLGPQIGWDLRFEEK
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaattattaagacaaacttttgctaatgcaaagaaggaaaaccgtaatgcttta
gtcacttttatgactgccggttatcctactatcgaggacactgttcctattttaaaaggt
ttccaagacggtggtgtagatgttattgaattgggtttaccgttttctgaccctattgct
gatggtccaactattcaagttgcaaacactgttgctttagaaaatggtgtaactatgata
aaagctttggaattattaagacaagctagaagtgaaggtatcactgttccaattattttg
atgggttactacaatccaatcttgaattatggcgaggaacaattcatcaaagatgctgct
gaagctggtgccaatgggtttatcattgttgatttaccacctgaagaagctttaaaagtt
agaaattacgttagagagaatggtgtcagtttagtgcctctaattgcaccatctactact
gatgaaagattaggtttattatcccacatagctgattcttttgtttacgttgtctcaaga
atgggtactactggtgctcaaacttcaatttcaagtgatctagatcaattggtctctcgt
gttagaaaatataccaaagatattccattagctgtcggttttggtgtttcgaccagagaa
catttcgaaactgtcggtgcatcttctgacggtgttgttattggttctaagattgtttcc
ctatgtagtgaagctgctcaagataaacgatatgaaactgctaagacttatgtagaaggt
atcttaaatggtaaaaaacatcatattctatccgtcgaagaattcaacgaacaacataaa
caatcgttaattgatgcaaagaattcttcgaaagttgataatgagttctctgaagaacat
aaatttccaactagatttggcgatttcggtggtcaatacgtcccagaagctttgcattca
tgtttaagagagttagaaagaggctttgaagatgctgtagctgatccaactttctgggaa
gaatttagatcattatattcgtacattggccgtccttcatctctacataaagccgaaaga
ttatccgaacattgtggtggtgctaccatttggttaaagagagaagatctaaaccacacc
ggttcccataagatcaataatgctttagctcaagttttgatggctaaaagattaggaaag
agcaatgttattgccgaaacaggtgccggtcaacatggtgttgctactgccactgcttgc
gctaagtttggtttgaaatgtaccgtttttatgggtgctgaggattgtcgtcgtcaagca
ttaaacgtctttagaatgaaaattctaggtgctgacgttgtcccagtcactaacggtact
caaactttaagagatgctacatccgaagctttccgtacttgggtaaccaatttaaagtct
acttattacgtcgttggttccgctattggccctcatccatatccaacccttgtacgaacc
tttcaaagtgtcattggtaatgaaaccaaagaacaatttgctaaattgaacaacggaaaa
ttaccagatgctattgttgcatgtgtcggtggtggttctaactctacaggtatgttctct
ccatttgaacatgatatttccgttagattaattggtgttgaagccggtggtgatggtatc
gattctgactatcattccgcaacactaactgttggcagaccaggtgttttccatggtgtc
aaaacttatgttttacaagataacgatggccaagtccatgatacacactctgtttcagct
ggtttagattacccaggtgttggtccagaattagcattctggaaggcttctggtcgtgcc
gaattcatggctgctactgacgcacaagctttagaaggtttcaagttattatctcaacta
gaaggtatcatccctgctttagaatcttctcatgccgtttatggagctatccagattgcc
aagaaaatgactccagaacaacatttaattatcaatgtttctggtagaggtgacaaagat
gttcaaagtgttgccgaagttttacctaaactaggtccacagattggttgggatttaaga
tttgaagaaaaataa

DBGET integrated database retrieval system