KEGG   Tetrapisispora phaffii: TPHA_0K02280Help
Entry
TPHA_0K02280      CDS       T02235                                 

Gene name
TPHA0K02280
Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tpf  Tetrapisispora phaffii
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:tpf00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11:490104..492107
Genome map
AA seq 667 aa AA seqDB search
MVDISEPIVPLIASVDVGTTSSRAILFNKLGQEVAKHQIEYSTTASKFKARKPKATDSPP
STSSSGSKYETQPRMLGGVAMKKTMTEDNQIFTAEGVAISQNDFVTIEELEDEVEQPTLR
FPQPGWVEVCPTNVLVYVVECLAATFEIIETLNVERVKHGFPIYKVTAMGIANMRETTLV
WSKETGKPLVNYGIVWNDTRNTKLVSDKQNATPKDMQEELRRITGLPVFSTYFSCSKLRW
LLDNEPVVKAAYDKSDLMFGTIDTWLIYHLTKSHTFVSDITNASRTGFMNLDTLDYDDRL
LEFWDIDRSKCSLPKIVSSAEYYGDFTVHEFIYDQLNVKSKKILDKYKDTHPIIPIQGCL
GDQSASLVGQMAFKPGAAKCTYGTGCFLLLNTGNLKLISKNGALTTFGYWFPYLENEEHS
KPHFALEGSVAVAGAVVQWLRDNLRLFPRAEDVGPLASQVKDSGGVVFVPAFSGLFAPYW
DPNARASIMGMSQYTTAAHIARAAVEGVCFQARAILKAMSSDVLQESGDFEDTYEKSALS
TLAVDGGMSRSDEVMQIQANILGPCVKVRRSPTSECTALGAAIAANMGFKNPDDRTLWRE
LPDVKRWVYYAGHAKGEKYTLPVEMNLKIFTSESSDKERREHWHLWETAIERSKGWLDSV
NGNSVAK
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atggtggatatttctgaacctatcgtccccttgatcgcatccgtggatgttggaactacc
tcgtcaagagctattttatttaataaattgggtcaagaggtagcaaagcatcaaatcgag
tattcaacaactgcttcgaaatttaaggcaagaaaaccaaaagcaacagattccccgcct
tctacatcatcttcaggtagcaaatatgaaactcagccaaggatgttaggaggtgtagca
atgaaaaaaacaatgacggaagacaatcagatttttacagcagaaggtgtcgctatttcg
caaaatgactttgtcacaatcgaagagttggaagatgaagttgagcaaccaactttaaga
ttcccgcaaccaggttgggtagaagtgtgtccaacaaatgtactggtttacgttgtagaa
tgtttggctgcgactttcgaaattattgaaactctaaatgtagaacgtgtaaaacatggt
ttcccaatttataaagtcaccgcgatgggtattgcaaacatgagagagactacgttggta
tggtccaaagaaacaggtaagccgcttgtcaattacggaatagtctggaatgatactcgt
aatacaaagttagtttctgacaaacaaaatgcaaccccaaaggacatgcaagaggaatta
agaagaattactgggttaccagtgttttctacctatttttcttgttccaaattaaggtgg
ttgctagataatgagccggttgtaaaggcagcatatgataaatcagatttaatgtttggt
acaattgatacttggttaatataccatttaacaaagtcacacacatttgtctcagacatt
acaaatgcttcaagaacaggttttatgaatttggatactttggattatgacgacagatta
ttagaattttgggacattgacagatcgaaatgtagtttaccaaaaattgtgtcatcggct
gaatactatggtgatttcactgtccatgaatttatctacgaccaattaaatgtaaagtct
aaaaaaatattggataaatacaaagatacccatccaatcattccaatccaaggttgctta
ggtgatcaaagtgcctcattagttggtcaaatggcctttaaaccaggtgccgcaaagtgc
acatatggtactggttgtttcttattattgaatacaggtaacctgaaattaatttccaag
aatggtgcattaactacatttggatattggttcccttacttggagaatgaggaacatagc
aaaccacattttgcactggaaggttccgtcgcagttgctggtgcagttgtacaatggtta
agagataatctaagactatttcctagagcagaagatgtgggccctttagcttcgcaagtc
aaagattctggcggtgttgtatttgttccagcatttagtggtctatttgctccatattgg
gatcccaatgcaagggcatcaattatgggaatgtcacaatacactacagctgcccatatt
gcaagagctgccgtagagggtgtctgtttccaggcaagagctattttaaaggctatgagt
agtgatgttttgcaagaaagcggtgattttgaagatacatatgaaaaatcagccttatcc
acactggctgtcgatggaggtatgtctcgttcggatgaagtcatgcaaattcaagcaaat
attctagggccatgtgttaaagtgagaagatcacccaccagtgaatgcacggctttaggt
gctgcaatcgctgcaaatatggggtttaaaaacccagacgatcgtactttatggagagaa
ttaccagatgttaaaagatgggtatattacgctggccatgcaaaaggtgaaaaatatact
cttccagttgaaatgaatttaaagatattcacaagtgaatccagtgataaagaaagaaga
gagcactggcatttgtgggagactgcaattgaaagatctaaaggatggttagattccgtc
aacggtaattcagtagctaaataa

DBGET integrated database retrieval system