KEGG   Tetrapisispora phaffii: TPHA_0L00710Help
Entry
TPHA_0L00710      CDS       T02235                                 

Gene name
TPHA0L00710
Definition
hypothetical protein
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
tpf  Tetrapisispora phaffii
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:tpf04141]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12:133310..135415
Genome map
AA seq 701 aa AA seqDB search
MRDKQVNSILYLVFLFFVFKVICISAVDEFPDPLTSANFEDEIKTGYHIIEFYSPYCSHC
KSLAPIWKETWEKFQKESASSKLKFSQVNCVESGDLCSQEKVRAYPKVSLYQNGSFIKDY
PDGNKRTVEQFIKFANEVIQENTENETDSTIDAISNLSKETIPLDKEAIINLLAGGAKFP
YFISFWPSDLNYQDDSFTFTNCKDCETFKEKWKSISEHLSDSGIQGAHFDCKKYPEVCKQ
LNFQELTIKDKEKSPILLLLVPMRKTNNIFEFKDSLDSPESMILDFATRTSFNAQLKHIT
KGEINEIINRKVDYNNSRSANKLFLVFQYNETQVFQEDFVVLEYLIEILNNYENIYLYQC
KDDLRTLILNSYDRFVDLINYNATESKKRRNDEYINMYSITQKPTFFIFREGDLLSSAFN
SYSTAEFRSPGYIVSWLDQVNLTKLTEVTEDNFSMLLQYANDIYQIITIQLIDTSSEDMI
NQSNQYLDNYLLALDDYEHTRMGYLVKLINKKRTDKSNKLDKMKNNKVDDKTIVRTKLQQ
LEYDFNKKILIAYIDISENLDLLNSYGIKPKDREFEVGDIIIINKQTLKVYYSDISGKDL
RASSPFELRESLTSVSIPEISNFKMKGKVLSKIHKSPSKSLHFNISHHLSPQNAIICIVV
VILIIFRKFIRHRVAKLLRKSENNDAASNNEFTLTKSKFND
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgagagacaaacaagttaatagtatactttacttggtttttctgttctttgtttttaaa
gtaatatgtattagtgctgtggatgaatttccagacccattaactagcgctaattttgaa
gatgaaattaaaactggatatcatataatagaattttatagtccatattgttctcattgc
aaaagtttagcaccgatatggaaagaaacttgggaaaagtttcaaaaagaatctgctagt
tcgaaacttaaattttcccaagtgaattgtgtcgagagtggtgatttgtgctcacaagaa
aaggtaagagcatatccaaaagtaagtttatatcaaaacgggagctttattaaagattat
cctgatggaaataagagaactgtcgaacagtttattaaatttgcaaatgaagtgattcag
gaaaatacagaaaacgaaactgattcgacaattgatgcaattagcaatttatctaaagaa
actattccattggacaaggaagcaataattaatttattagctggaggagccaaattccct
tattttatatctttttggccgtctgacttaaattatcaagatgatagctttacttttaca
aattgtaaagattgtgaaacttttaaggaaaaatggaagtcaatatccgaacatttatct
gattcaggtatccaaggtgctcatttcgattgtaaaaagtatccggaggtttgcaagcaa
ttgaattttcaggagttaacaattaaagataaagagaagtctcctattttattgttactt
gttcctatgagaaaaactaacaatatttttgagtttaaagattccttagattcacctgaa
tcaatgatattggattttgcaacaagaacatcgttcaatgctcaacttaaacatatcaca
aagggagaaattaatgaaataatcaatcgtaaggttgattataataactccaggtccgct
aacaaactatttttagtatttcaatataacgaaactcaggtatttcaggaggattttgta
gtattggaatatttgattgaaatactaaataattatgaaaacatatatctttatcaatgt
aaagatgacttaagaacattgatattgaattcctacgacaggttcgtcgatctaattaat
tataatgctacagaatctaaaaaaagaagaaatgatgagtacattaatatgtattcaatt
acacaaaaacccacattttttatttttagagaaggtgatttgctttcttcagctttcaat
tcttattcaacagctgaatttagatctccgggatatattgtatcttggctggatcaggta
aacttaactaaattaacagaggtaacagaagataatttttcaatgttattacaatatgca
aatgacatataccagatcattactattcaactaatagacacatcttctgaagatatgatt
aatcagagtaatcaatatttggataattacttgttagcacttgatgattatgagcataca
aggatgggttatttggtaaaattaattaataaaaaaagaactgataaaagcaataaatta
gataagatgaaaaataataaagttgatgacaaaacaatagtgagaacaaaattacaacaa
ttagagtatgattttaataagaaaattttaattgcgtacattgatatttcagagaatttg
gatttgttaaactcatatggtatcaaacctaaagacagagaatttgaagtaggcgacatc
attattattaacaagcaaacgctgaaagtttattattctgatatatctggaaaggactta
agagctagttctccttttgaattgagggaaagtttaactagtgtgtcaattccagagatt
tcaaattttaaaatgaagggtaaagtattgagtaaaattcataaatcaccctcaaaatct
ttgcattttaacatatcacatcatttatcccctcaaaatgcaataatatgcatagtagtt
gttattctgataatttttaggaagtttatcagacatagagttgctaaactactacgaaag
tcagaaaacaatgatgctgcctctaacaatgagtttacattaacaaaatcaaaatttaac
gactaa

DBGET integrated database retrieval system