KEGG   Tetrapisispora phaffii: TPHA_0L01100Help
Entry
TPHA_0L01100      CDS       T02235                                 

Gene name
TPHA0L01100
Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
tpf  Tetrapisispora phaffii
Brite
Exosome [BR:tpf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TPHA_0L01100 (TPHA0L01100)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12:complement(230363..230755)
Genome map
AA seq 130 aa AA seqDB search
MSSASKAPASKAPAEKKPAAKKTSTSVDGKKRTKARKETYSSYIYKVLKQTHPDTGISQK
SMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRA
VTKYSSSTQA
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccgcttccaaggccccagcttccaaagccccagctgaaaagaaaccagctgcc
aagaaaacctccacttccgtcgacggtaagaagagaactaaggctagaaaggaaacttac
tcttcctacatctacaaagttttgaagcaaactcacccagacaccggtatttctcaaaaa
tccatgtctatcttaaactctttcgttaacgatattttcgaaagaattgccactgaagct
tctaaattagctgcctacaacaagaagtctaccatttctgctagagaaatccaaactgct
gtcagattaatcttaccaggtgaattggccaagcatgctgtttctgaaggtaccagagct
gttaccaagtactcttcttctactcaagcttaa

DBGET integrated database retrieval system