KEGG   Tetrapisispora phaffii: TPHA_0L01380Help
Entry
TPHA_0L01380      CDS       T02235                                 

Gene name
TPHA0L01380
Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
tpf  Tetrapisispora phaffii
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TPHA_0L01380 (TPHA0L01380)
Enzymes [BR:tpf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     TPHA_0L01380 (TPHA0L01380)
Exosome [BR:tpf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TPHA_0L01380 (TPHA0L01380)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12:complement(287401..289086)
Genome map
AA seq 561 aa AA seqDB search
MIRSTNYDPISDPAYKAPRKVVSNKKKRSVLLTAVLTSVIMLLCMQLLVPGSLAFEHSRK
TNKKNVIFFVTDGMGPTSLSLARSYRQFKYNLPYNDVLTLDKHLIGSSRTRSSDSLVTDS
AAGATAFACALKTYNGAIGIYPDTQPCGTILESAKLNGYMTGLVVTTRITDATPASFSAH
VNMRSQEDQIALQQLGHYVLGNMVDLMIGGGRTHFYSGEVESLNITNGARKDGRNLITES
IENGWQYAGNKKEFDSLDGGKNVSLPLLCLLADDNIPFDVDRDENEFPSIKEQAMVAINA
LHEGTKDSEEGFFLMIEGSRIDHAGHNNDPAAQVREVLAFDEAFKAIIDYADSSDVDTII
LSTSDHETGGLVAARQNEKDMIEYLWYPEILDNAKHSGEYLAQKISTFYKSNSLNSDKDD
VNKSKSNFIKHEILEKELNIKDYTKEDIAELLSYGNDFMSIHYKLNDMVSMRAHVGWSTH
GHSAVDVNIYAYSNNRQLWHDILDHLQGNHENIEIGTYMAKIMNLDLEKVTDLVKDVEHD
PPKDFVSDLSAYVDQYHHKVI
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgataagatcaacaaattatgacccaatatcagacccggcatacaaggcaccccgcaaa
gtcgtgtcgaacaaaaagaagaggtcggttttgctaactgcagtgctaacctccgttatt
atgctcttgtgcatgcagcttttggtcccaggatcattggcttttgagcactccagaaaa
acaaataaaaagaatgtcatttttttcgttactgatggaatgggtccgacttcattatcc
ttagcaagatcctacagacaatttaaatacaacttaccatacaatgatgttttgaccttg
gataaacatttgataggctcctctcggacaagatccagtgattcgttagtcactgattca
gctgcgggcgccacagccttcgcatgtgctttaaagacgtataatggggccatcggtatt
tacccagatacacagccttgtggaacaattttggaaagtgcaaaattaaacggttacatg
actggtttggttgtcacaacaagaataacggacgcaacacctgcttcctttagtgcccat
gtcaacatgaggtcccaagaagatcaaatcgctttgcagcagctaggccactatgtattg
ggaaacatggtagacttgatgataggtggtggtagaacacatttttatagtggagaagtt
gaatctcttaatattacaaatggtgctaggaaagatggtagaaatttgattacggaatca
atcgaaaatggatggcaatacgccggaaacaaaaaagaattcgatagcttggatggtggt
aaaaatgtttcattaccattattatgtctattagctgatgacaacattccattcgatgtt
gacagagacgaaaatgaatttccatccataaaagaacaagcaatggtagccattaacgca
ttacacgagggtacaaaggattcggaagaaggtttctttttaatgatcgaaggttcaaga
attgatcatgcaggccacaacaatgatcccgctgctcaagtaagagaagtattagccttt
gacgaagcttttaaggcaattattgattacgcagattctagtgatgttgataccatcatc
ttgtcaacctcagatcatgaaactggtggactagttgctgccagacaaaatgaaaaagat
atgattgaatacttatggtacccagagattttagataatgccaaacattctggtgaatat
ttggctcaaaaaatctcaactttctacaaatccaattcattgaatagtgacaaggatgac
gtaaataaatctaaatctaatttcattaaacatgaaattttggaaaaggaacttaacatc
aaggactacacaaaggaagatattgcggagctcctttcgtatggaaatgatttcatgagt
atccattacaagctaaacgacatggtctctatgagagctcatgttggttggtccacacat
ggacattctgcggttgatgtcaacatatatgcttattcaaataacagacaactttggcat
gatattttagatcacttacaaggtaatcacgaaaatatcgagatagggacatatatggca
aaaattatgaatctcgacctcgaaaaagttactgacttagtcaaagatgttgagcatgat
ccaccaaaggattttgtctccgatttatctgcatatgtcgatcaatatcatcacaaagtt
atttga

DBGET integrated database retrieval system