KEGG   Tetrapisispora phaffii: TPHA_0L01670Help
Entry
TPHA_0L01670      CDS       T02235                                 

Gene name
TPHA0L01670
Definition
hypothetical protein
Orthology
K11874  
ubiquitin carboxyl-terminal hydrolase 16 [EC:3.4.19.12]
Organism
tpf  Tetrapisispora phaffii
Brite
Enzymes [BR:tpf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     TPHA_0L01670 (TPHA0L01670)
Peptidases [BR:tpf01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TPHA_0L01670 (TPHA0L01670)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12:complement(351116..352690)
Genome map
AA seq 524 aa AA seqDB search
MWEFSRINSFIFSYYKNNQTKLILHTCTALVLSYILVPTFKSCLEYILINKKLDNNQESK
REDKYTTGLINSSTYCFINSSLQALSSLPKFTIYLNETLKITYGFIQNNHLSSNIERSKI
SPLDDYGSLRQIIPLHIAVSEFLFDLQKIVTKPTSTSVRQLIKVLEVSVHLKFNNGQQDA
HEITQILLETLKNENKVLDQTFKKSGESQMVVPEFPFLGCQTDSLICLTCNRTSNVREHE
FIILTLHLPRIQSDTLLNTINKNQVEEITDYACLVCQINSILANEEYLKRNNNGKTINAE
ESRYIDTLRQLVPKICINEELPDDVIYYIKSYNKNGLNVCQKIRSKIIKKTVITKAPLAL
ILHLSRSSYNGMISVRNSCNIAYDSKLELQSQSITDNICSDIVNNKYSLQAMVKHTGTHM
EGHYQCYRKKPNLVKRISYEQNGNDIIKKYDIINRTPVIQLKLDVDNNMQQRTIGVLESK
TKKLNSIKSKPYWKISDTDISEVTENQVINESKYVYMLYYDLAS
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgtgggaatttagtagaataaattcatttatcttttcatactacaaaaataatcaaaca
aaattaattttacacacatgtactgcccttgtattgagttatatattagtcccaacattc
aagtcgtgcttagaatatattcttataaacaaaaaattggacaacaatcaggaatcaaaa
cgagaggataagtataccacaggattaattaattcaagtacatattgttttatcaattct
tccttacaagcactatcctcactgccaaaatttactatttatttaaatgaaacattaaag
atcacatatgggtttatacagaacaaccatctatcttccaatattgagagaagtaagatc
tcacctttagacgattatggatcactgagacaaattattcctttgcacatagctgtctct
gaatttttattcgatttacaaaaaatagtaactaaacctacaagtacatctgtgagacaa
ttgattaaagtgttggaggtatctgtacatctcaagttcaataatggtcagcaagatgcc
cacgagataactcaaattcttttagaaactttgaagaacgaaaataaggtattagatcaa
actttcaagaaaagtggtgaatctcagatggtagtgcctgaatttccattccttggctgc
caaactgattcgttaatatgcctaacctgtaatagaacatcaaatgtaagagagcacgaa
ttcatcattctaactctccatcttcctcggatacaatcagatacactactaaatacgatc
aacaagaaccaagttgaagagatcactgattatgcgtgtttggtttgtcaaataaattca
attctagctaatgaagaatatttaaagaggaacaacaacggtaaaacaataaatgccgaa
gaatcaagatatattgatacattaagacaactggtaccaaaaatttgtatcaatgaagag
ttaccagacgatgtaatatactacattaagtcatataataaaaatggtttaaatgtctgt
caaaaaattaggtcaaagatcatcaagaagacagtaattacaaaagcacccctagcttta
attcttcacctctcaagatcttcttacaatggaatgatttctgttagaaattcttgcaac
attgcctacgacagcaagctagagcttcagagccaatcgattaccgataacatctgcagt
gatatagttaataataagtatagtttacaggcaatggttaaacatacgggcacacatatg
gaaggacactaccaatgttatagaaagaaacccaatttagtaaaaagaatttcctatgaa
caaaatggcaatgacattattaagaaatacgatatcataaacagaacacctgtaatacaa
ttgaagttagatgtagacaacaacatgcaacagcgtacaatcggagttcttgaatccaaa
accaaaaagctgaactccataaagagtaaaccatattggaaaatatcagatactgacatt
tctgaagttacagagaaccaagttatcaacgagtccaagtacgtctacatgttatactac
gatcttgcttcttga

DBGET integrated database retrieval system