KEGG   Tetrapisispora phaffii: TPHA_0L01830Help
Entry
TPHA_0L01830      CDS       T02235                                 

Gene name
TPHA0L01830
Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
tpf  Tetrapisispora phaffii
Brite
Enzymes [BR:tpf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TPHA_0L01830 (TPHA0L01830)
Transfer RNA biogenesis [BR:tpf03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    TPHA_0L01830 (TPHA0L01830)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12:383253..384941
Genome map
AA seq 562 aa AA seqDB search
MGRHGKGPKTNKSQNLAPEKERFIQCCTDITLELTNSLTSSSTREINLNGLITKYSKKYK
LKQQPRLTDIINSIPDQYKKHLLPKLKAKPVRTASGIAVVAVMCKPHRCPHIAYTGNICV
YCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYEQARGRVEQLKQLGHSIDKVEYVVM
GGTFMSLPKDYREDFIVNLHNALSGFNGTDIDEAIKYSQQSLTKCVGITIETRPDYCTPT
HLDDMLKYGCTRLEIGVQSLYEDVARDTNRGHTVKSVCETFAIAKDAGYKVVSHMMPDLP
NVGMERDIEQFKEYFENPDFRTDGLKIYPTLVIRGTGLYELWKTGRYQSYNANALVDLVA
RIMALVPPWTRIYRVQRDIPMPLVTSGVDNGNLRELALARMKDFGTTSRDIRTREVGIQE
VHHKIQPDQVELIRRDYYANGGWETFLAYEDPKQDILIGLLRLRKPSKKHTYRKEFTAQR
TSIVRELHVYGSVVPLHSRDPRKFQHQGFGTLLMEEAERIAREEHGSEKISVISGVGVRN
YYAKLGYELDGPYMSKKYKSGL
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgtcacggtaagggtccaaaaactaacaagagccagaatttggcaccagaaaaa
gagcgttttattcaatgttgcactgatatcactttagagttgactaattctctaacatcc
agttccaccagagagattaatttgaatgggctgattacgaaatactcgaaaaaatacaaa
ctgaaacagcagcctaggttgaccgatattatcaactctatcccagatcaatacaagaag
catttattgccaaaattgaaagcaaaaccagttagaacggcatctggtatagctgtggtg
gccgttatgtgtaaaccacatcgttgtccacatatagcctacactggtaacatttgtgtt
tactgtcccggtggtccggactcggatttcgagtattccactcaatcgtatactggttac
gagcccacatcgatgagagccattagagctcgttatgacccttacgagcaagctagaggt
agagtagaacaactaaagcaactgggtcactccatcgataaggttgagtacgttgtcatg
ggtggtactttcatgtctttacctaaggactatcgtgaagattttattgtcaatttgcat
aacgctttatcaggtttcaatggtactgatattgatgaggcaattaaatattcccaacaa
agtttaacaaagtgtgtcggtatcacaattgaaactagaccggattattgtactccaact
catttggatgatatgttgaaatatggttgtacaagattagagattggtgtacagtcatta
tatgaagatgtcgcacgtgatacaaatagaggtcatactgttaaatctgtctgtgaaact
tttgctattgctaaagatgcaggttataaagtcgtttcacatatgatgcctgatctacca
aacgttggcatggagagagatattgaacaattcaaagaatattttgaaaatccagacttt
agaacagatggtttgaaaatttacccaacgttagtcatcagaggtacaggtttatatgaa
ctatggaaaacaggacgttatcaatcttataatgctaatgccttagttgatttagttgcc
agaattatggcattagtcccaccgtggacaagaatttaccgtgtccaaagagatattcca
atgccactggttacctcaggtgtggataatggtaacttaagagagttagcactagcaaga
atgaaagattttggtacaacttcccgtgatattcgtacaagagaagtcggcatacaggaa
gtgcatcacaagattcagccggatcaagttgaattgatcagaagagactattatgctaat
ggtggttgggaaacattcttagcctatgaagatccgaagcaagatatcttgattggtctt
ctaagattaagaaaaccttctaagaagcatacatatagaaaagaatttactgcacaaaga
acatcgatagttagagaactacatgtatacggttcggttgttccattgcactctagagat
ccacgtaaattccaacatcaaggttttggtactttgcttatggaagaagctgagagaatt
gcacgtgaagaacatggctctgagaagatttcagtcatttccggtgttggtgtaagaaat
tactatgcaaaattaggttacgaattggatggtccatatatgtctaaaaaatataaatca
ggattgtga

DBGET integrated database retrieval system