KEGG   Tetrapisispora phaffii: TPHA_0L02130Help
Entry
TPHA_0L02130      CDS       T02235                                 

Gene name
TPHA0L02130
Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
tpf  Tetrapisispora phaffii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12:complement(441224..445750)
Genome map
AA seq 1508 aa AA seqDB search
MTIFGPQPLRPLNTETRHGFEEQYNSKEFLEALANSFLFYYDDKRHLTNGNPVPDDEIKE
DKNRYYQPILDWKIMKDRQKTVSVALLLCLNLGVDPPDVIKTQPCARVEAGIDPLNFQDS
KKAIEQIGENLQSQYESLSLRARFKQSLDPSVEDVKRFCYSLRRTSKEDRILFHYNGHGV
PKPTPSGEIWVFNRGYTQYIPVSLYDLQTWLGAPCIFVYDCNCAENIVSNFQTFVQKRIK
DDESGKHDPAAPSPTIAYSECFQLAACRSNELLQTAVELPADLFTCCLTNPIEISVKVFL
LQSPLNKSKYRVFFESQDSNDRIDFNDDISGIAPKIKIPGTISDRRTPLGELNWIFTAIT
DTIAWTSLPRPLFKKLFRHDLMVAALFRNFLLAKRIMPLYNCHPVSDPHLPDIVADHPMW
KSWDLAIDELLSKLVADMENSKFTDTESTALFNQDDSLQLHINTGSQEQRPQNSRMPSRF
AAGNLSNMSLAAHPSLHNRGKESVTSLKNVPQVKKQFTDFFEQNLTAFELWLKYYSNSRN
PPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVLKLLQSPAPELK
PILVFIWARIMAIDYKSIQSDLLKEKGYMYFVNILIADYGATLEGGESSLNNNPQITMTI
PHLNNPVFYQNNGRLPGAFPYNETTDEQKAMAVFILAAFIRDFPQAQKQCFSIELINMLS
YYLLYSDIPLLRQWSAILLGQFCDHNPLNKYIYMDLDITSSLIKALTDLVPEVRAASLNA
LSYFISEADDVETLLGIEKEYTYHLQQLHTQLQQFKTANHRQNQQLEQQQMNLERQIQIY
QNMQARLQNVDFSLLKVQGIYNVVAILKLVEDGSPFVRKEVIIFLSKFVHRYINFFVVVF
FEFLVDELIQLDNIGKNNVLKVNKNNVSHGSIFSSVWKTLLIFSCDPFEENKELANKVID
YIFFEVNMNKEFKVSLRKIGENLIKRSSNWNQKQANSFNASHIQVIGKQDSKFHSNRDEN
SSDEKESLSGQFFLTKIFNSLGFGENYGSDTFSSSYSRTESGPPSRRSHLEDGVLNRPKR
VNIDPINKEYTLPLKGQFLDFCFEYFQEPQMKKHEIDEVGSVEYNTRLWRRNRNEEIIEK
TQSEKTLALYGNWNNRISIFDNKSQPKLLEFTQFDNYLVAADERDCITVYDWANDDVLNK
FSNDNPYGTKITSLKFLNEDDSSLLLTGSSDGILKIYKDIDKNGNTTIVSAWRGLTDMLL
TPRSTGLLTEWQQSKGSLLVTGDVKVIRVWDAHSESIEVDIPVKTSSLVTSITSDQLAGD
TVVCGFSDGSIRVYDRRLNSRDAMVRLWRSNEGKKHYPINYVHLQRGGFRELASGTTDGT
VELWDIRNQDPITSFNIGSSNQSSESRISTMTKMQLHEHGPILATGTKQVSIWTTAGDLL
STFDNTSHNSGIVGTFGASGIRSSLTLANSNSGSFLSSLAFHPHRMMLAASNSHDSKISI
YSCENKFD
NT seq 4527 nt NT seq  +upstreamnt  +downstreamnt
atgactatttttggtccacaacctttaagacctctgaatacagagactagacatggtttt
gaagaacaatataacagtaaagaatttttagaagcactggcaaattcatttttgttttac
tacgatgataagagacatttaacgaacggaaatcctgtaccagatgatgaaataaaggaa
gataaaaatagatattatcaacctatcttagattggaagattatgaaagacagacaaaag
actgttagtgttgctttacttctttgtctaaatcttggagtagatccgcctgatgtaata
aaaactcaaccatgtgccagagtagaagctggcatagatccactgaattttcaagattct
aagaaggcaattgagcaaataggtgaaaatttacaatcgcaatacgaaagtttatcatta
agagccagatttaaacaaagtttagatccgtccgttgaagatgttaaaaggttttgttat
tcccttagaagaacatcaaaagaagatagaattttatttcattacaatggacatggtgtg
ccaaaacctacaccttccggagaaatttgggtttttaatagaggatatacacaatatatt
ccagtatcattatatgatctgcaaacatggcttggggcaccttgcatttttgtctacgat
tgtaattgtgcagaaaatattgtttcgaatttccaaacttttgtccaaaaaagaatcaaa
gatgacgaatcaggaaagcatgatccagctgcaccttcaccaactattgcatattctgaa
tgttttcaattagcggcatgtagatctaatgaactactgcaaacagctgtagaactacca
gcggatttatttacatgttgtttaactaatccaatcgaaataagtgtcaaagtgttttta
ctacaatctccattaaacaaatcaaaatatagagtattttttgaatcacaagatagcaat
gatagaatagattttaatgatgatatcagtggaatagcacctaaaataaaaataccgggc
accatttcggatagacggaccccattaggtgagttaaattggatttttaccgccatcact
gataccatagcatggacatccttaccacgtcctcttttcaaaaaactatttagacatgat
ctgatggtagctgctttattcagaaattttttattagcaaagagaataatgccactatat
aactgtcacccagtgtctgatcctcatttacctgatattgtagcagatcatcctatgtgg
aaatcttgggatttagctattgatgaattattaagtaaacttgttgctgacatggaaaat
tcaaaatttactgacactgaatctactgcattatttaatcaagatgatagcttgcaattg
catataaacacaggttcacaagaacaaagaccacagaattcaaggatgccatcgagattt
gcggctggaaatttaagtaatatgtctcttgctgcacatccctcactacacaatcgtggc
aaagaaagcgtaacttcactgaaaaatgtacctcaagtcaaaaaacaatttactgatttc
ttcgaacaaaatttaactgcatttgaattgtggttaaaatattattccaattcacgaaac
cccccagaacaactcccgattgtccttcaagtgttgctatcacaagttcatcgtataaga
gcattggtattattgtcaaggtttttggatttagggccatgggctgtctatctttcctta
tctattggtattttcccttatgttcttaaattattacaaagtccagctcccgaactaaag
cctattctagtatttatttgggcaaggatcatggccattgattacaaaagcatacaaagt
gatctcctaaaagaaaagggatacatgtactttgtaaatattctgattgcagattatgga
gcaaccttggaaggtggtgaatcatctttgaataacaaccctcaaataacaatgacaatt
ccacatttgaataatcctgtgttctatcaaaataatggtagattgccaggtgcatttcct
tataatgaaactacagatgagcaaaaagccatggctgtttttattctagctgcatttatc
cgtgactttccccaagctcagaaacagtgtttcagtattgaattaattaatatgttatca
tattatttgttatattctgacattcctttactaagacaatggtcagctatattattaggc
caattctgtgaccacaatccattaaataaatatatttatatggatctagatataacatca
tctttaatcaaagcattgacagatttagtaccagaagtaagagctgctagtttaaatgct
ttatcatattttatctctgaagctgatgatgtcgaaacactcctaggaatagaaaaagaa
tatacttaccatctccaacaacttcacacacaattacaacaatttaaaactgcaaatcat
cgacagaatcagcaactagaacagcaacaaatgaatttggaacgccaaattcaaatttac
caaaatatgcaagcccgcttacaaaacgtcgacttttccctactgaaagttcaaggtata
tataatgttgttgctattttaaaattagtggaagacggttcgccattcgttaggaaggaa
gtgattatctttctttccaagtttgttcatcgttatatcaatttttttgttgttgtgttt
ttcgagtttttggtcgatgaattaattcagctagacaatataggtaagaacaatgttctg
aaagtgaataaaaataatgtcagtcatggttccatttttagtagtgtttggaaaacgtta
ctgattttttcttgtgacccatttgaagaaaacaaggaactagcaaataaagttattgat
tatatattttttgaggtcaatatgaataaggaatttaaagtgtcattacgaaagatagga
gaaaacttaattaaaagatcttcaaattggaatcagaaacaagcaaactccttcaatgca
tctcacatacaagttattggcaaacaagactctaaatttcattctaatagagatgagaat
agttcagatgaaaaggaatctctttctggtcaattctttttaacaaagatttttaattcc
ctcggatttggagagaattatggttcagatacattttcttcttcttattcaagaacggaa
tcagggccaccatctagaagaagtcatcttgaagatggtgtgttaaataggccaaaaaga
gttaatattgatcccatcaataaggagtatacgcttccactaaaaggccagtttcttgac
ttctgttttgaatatttccaggaacctcaaatgaagaaacatgaaattgacgaagttgga
agtgtcgaatataatacaagattatggaggagaaacaggaacgaagaaattattgagaag
actcaatcagaaaagacattggcactttacggtaattggaataatagaatatctatattt
gacaataaatcacaacctaaacttttagaatttacacaatttgataattatttagttgct
gccgacgaaagagattgcattactgtctatgactgggcaaatgacgatgtcttgaacaaa
ttctcaaacgacaatccatatggtacgaaaattactagcttaaaatttttaaatgaagat
gactcctccttattattgactggatcttcagatggtatcctaaagatatataaagatatc
gataagaatgggaatacgaccattgtatctgcttggcgtggtctgactgatatgttatta
acaccgagatccaccggtcttctaactgaatggcaacaaagtaaaggttctttgttagtt
acaggtgatgttaaggttataagagtatgggatgctcattctgaaagtattgaagttgat
atacctgtcaaaacatcgtcattggttacatcaattacttcagaccagctcgctggtgat
acagttgtttgcggtttttcagatgggtctattagagtatatgatcgtcgtttaaactct
agagatgcaatggttcgattatggagatcaaatgaagggaaaaaacattacccaataaac
tatgtacatttacaaagaggtggttttagggagttggctagtggtacaactgatggaact
gtagagttgtgggatataagaaatcaggatccaataacgagttttaatattggttcgtct
aatcaatctagtgaatctaggataagcacaatgacaaaaatgcaacttcatgagcatggg
ccaattttggctacagggacaaaacaagttagtatttggactactgctggtgatctatta
tctacttttgataatacatcccataatagtggaatagtaggtacctttggtgcatcaggt
atccgttcgagtctaactttggcaaattcaaactcaggctcgtttctatcctcccttgca
ttccacccacatagaatgatgctggctgcttcaaactctcatgattccaaaatttcgatt
tattcctgtgaaaataaattcgactag

DBGET integrated database retrieval system