KEGG   Tetrapisispora phaffii: TPHA_0L02190Help
Entry
TPHA_0L02190      CDS       T02235                                 

Gene name
TPHA0L02190
Definition
hypothetical protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
tpf  Tetrapisispora phaffii
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TPHA_0L02190 (TPHA0L02190)
Enzymes [BR:tpf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     TPHA_0L02190 (TPHA0L02190)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12:complement(455643..456344)
Genome map
AA seq 233 aa AA seqDB search
MEESRTGTPLNTKPSKPYTLTPPIEADGLSWPSIGSRIRAEEDEEDEQKRVDRISEAVKT
ILVELGEDVDREGLLDTPQRFAKAMLYFTKGYQTNINDDVINNAVFEEDHDEMVIVRDIE
LYSLCEHHLVPFFGKVHIGYIPNKKVIGLSKLARLAEMYARRLQVQERLTKQIAMALMKI
LKPLGVAVVIEASHMCMVSRGVQKTGSSTVTSCMLGGFRSHRTREEFLSLLRR
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaagcagaacaggcacgcctttgaataccaaaccatccaaaccatatactcta
acaccaccaattgaagctgatggactctcatggccaagtattggttcaagaattagagct
gaggaagacgaagaagatgagcagaaaagagtcgacagaatatctgaagctgtaaagacg
attctggtcgaattgggagaagatgttgaccgtgaaggtctcttggatacaccacaaaga
tttgcaaaggctatgctatacttcactaaaggttatcaaacaaatattaatgatgatgta
ataaataatgctgtgttcgaggaagaccatgatgagatggtcattgtcagagacatagaa
ttatattccttatgcgagcatcacttggttcccttttttggtaaggttcatataggctac
attcctaataagaaagtgataggtttaagtaaattagcaagattagctgaaatgtacgca
agacgattacaagtacaggaaagattgacaaagcaaattgctatggcattgatgaagatt
ttaaaacctttaggtgttgctgtggttatagaagcttctcatatgtgcatggtctccaga
ggtgtccaaaagacaggctcttcaactgttacttcgtgtatgttaggtggtttcagatca
cacaggactagggaagaattcttgagtttgttacgtagatag

DBGET integrated database retrieval system