KEGG   Tetrapisispora phaffii: TPHA_0L02290Help
Entry
TPHA_0L02290      CDS       T02235                                 

Gene name
TPHA0L02290
Definition
hypothetical protein
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
tpf  Tetrapisispora phaffii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12:479360..482941
Genome map
AA seq 1193 aa AA seqDB search
MSVEESSHPGSILETPAFTKSINDVLVNLDTGGEDAIKMDTEGVFTWHIDNWNVLKNDKV
VSPQVTIGDFDWDVLLFPQGNRNKSLALYLEPNPKMVKDTEEDKMVPEDPAWYCCAQFAV
VLSRPGSDNEIYVINRSHHRFDNFDTDWGFANLIDLYSLKNQIKGKLSGFVTEDGQLNIT
VYVRILEDKNGVLWHNFVNYDSKKVTGYVGFRNQGATCYLNSLLQSYFFTKYFRKLVYEI
PTDEEKPNDSVPLALQRAFYQLQVSNLPLDTLELTRSFGWDSADAFTQHDVQELNRILMD
RLETRMKGTKVEGKLSELFVGKMKSYIKCKNVDYESSRVEEFWDIQLNVKDLKNLQQSFE
NYIEVELMDGENQYAAPDFGLQDAYKGVVFESFPKVLHLQLKRFEYDFNFDQLIKINDRY
EFPDSIDLSPYLDKDVLKNENETESHIYKLHGVLVHTGDISTGHYYTMIKPDLGDQWYRF
DDERVWKVDRKQVFDENFGLDKLPDSELRGMTKEEYQSYLITRHTSAYMLVYVKDEVEEE
ILQPVTETDVPQHVVKSIKEETEQYELREKELREAHLYVKFNIHTIKNFLSYQGFDISPN
PDSELFDEELYGKKAMPLSLKVSRKLYLKDLYKQINELAGIPHGKNVRYWKMDYRKGGTL
RLVTPMNSDLDSVTLEEATGYKEDELFPLMDIFIEEPYLDLQYLSSLKEKNILESVELTE
ELIDNLRQNIFKLVPSDYLPIIHDIKTHSLIFIKKFSLANQTLVGYGHQVVAKNDEINFI
ANTLSKISGIPTDIIQFFEEISPNCVQMTKLSDKIFEAELISGDILSFQDTSVADINCFP
LYENITQFYNFLRYRVKLVFSKAKNSVDDYVVNTANSKTFEVWVPVNISYDELANIVSQN
INEKAEYLKLFAIYPNEKYNLRSNCILKDYLLRDYNCSLTPTFEYEVLSMPLKDLESLRS
IRLYWLTDTYIHFQLYDFKIPNHFSVKEFKDKIQNKVGFSDSDKNNILFWTNSNFKFANV
IFDNNSFDDVGKGVLLFARILPEELKLLHHLDNLENTDETESYSSTNESNSTTQDHKKPN
DHLVVVMQCFKGIENRHGISFLFDLRPNENLSDAKSRLHKKFGLGEREFNKIKFNLLVRT
YTGKVLKSLQDLTEEEEQKIILYNIMGHLDIIYMDHPDRLKSQSSQDRPMTIK
NT seq 3582 nt NT seq  +upstreamnt  +downstreamnt
atgtccgttgaggagtcttcgcatcctggcagtattttggaaactcctgcttttactaaa
tcaattaatgatgttctagtgaatttggatacgggtggtgaagatgcaatcaaaatggac
actgagggagtgttcacatggcatattgataattggaacgtcttaaaaaatgataaagtt
gtttctcctcaagtgacaatcggtgattttgattgggatgtcttgttattccctcaaggc
aatagaaataaaagtttagcattatatctggagccaaaccctaaaatggtgaaggataca
gaagaggataagatggtacctgaagatccagcatggtactgttgtgcacagtttgctgtg
gtcttgtcgagacctggttctgataacgaaatttatgtaatcaatagatctcatcatagg
ttcgataattttgatacagattggggttttgctaatttgattgatttatacagtttgaaa
aatcaaattaaagggaaattatctggttttgttacagaagatggtcaattaaatatcact
gtttatgttcgtatcctcgaagataaaaatggtgtattgtggcacaattttgttaactat
gactcaaaaaaagttacaggttatgttggttttaggaaccaaggagcaacttgttatttg
aattcccttttgcaatcatattttttcacaaaatatttcagaaagttggtgtatgaaatt
ccaactgacgaagaaaaacctaatgatagtgttccattagctttacaaagggctttctat
caactccaggtctctaatttgccgctggataccttggaactgaccagatcatttggttgg
gattctgcagacgcgtttactcaacatgacgttcaagaattaaatcgtatattgatggat
agattagagacaagaatgaaaggtacaaaagttgaaggtaagttaagtgaattattcgtt
ggtaaaatgaaaagttatataaagtgtaaaaatgttgactatgaatcttcaagagttgaa
gaattttgggatattcaattaaacgttaaagacttaaagaatctacagcaatcttttgaa
aattatattgaagttgaattaatggacggtgaaaatcaatatgcagctccagattttggc
ttgcaagatgcatacaaaggtgttgtatttgaatcattcccaaaggtgttgcacttacaa
ttgaaaagatttgaatacgattttaattttgaccaactgataaaaattaacgacagatat
gaatttccagatagcattgatttatctccttatttggataaagatgtgttgaaaaatgaa
aatgagactgagtcgcacatttataagttacatggtgtgctggttcatactggtgacatt
tctactggtcactattatacaatgattaaaccagatttaggagatcagtggtatagattc
gatgatgaaagagtttggaaggttgataggaagcaggtctttgacgaaaattttggttta
gacaagttaccagattcagaactacgcggtatgacaaaggaggaatatcagagttatttg
attacaagacatacaagtgcatatatgttggtttacgtaaaagatgaggtagaggaagaa
attctacagccagtcacagaaactgatgtccctcaacatgttgtcaagagcattaaagaa
gaaactgaacaatatgaattgagagaaaaggaattgagagaagcacatctgtatgttaaa
ttcaatatccataccataaagaatttcttgagttatcaaggatttgatatatcaccaaat
cctgattctgaattgtttgatgaagaactttatggaaaaaaggccatgcctttgagtttg
aaagtttccagaaagttatatttaaaagatctttataaacagattaatgaattagctggt
attcctcatgggaaaaatgtaagatattggaaaatggattaccgtaagggtggaacttta
cgtttagtaacaccaatgaattctgacttagattctgtaacattagaagaagctacagga
tataaagaagatgaattgtttccattgatggatattttcattgaagagccatatttggac
ttacaatacttgtcttcgttaaaagaaaaaaatattctagagtcagttgagttaacagaa
gaattaattgacaatctaagacaaaacatttttaaattagttcctagtgattatctccca
ataattcatgatataaaaacgcattcattaatattcattaaaaagttttcattggctaat
caaacgctggttggatatggccatcaagttgttgcaaagaatgatgaaataaattttatt
gcaaataccttatcaaagatatctggtatacctactgacattatacaatttttcgaagaa
ataagtccaaattgtgtacaaatgacaaaactatccgacaaaatatttgaagctgaattg
attagtggtgatattttgtcttttcaagacacttcagtggcggatataaattgtttccca
ttatatgaaaatataacacaattttataatttccttcgttatagggttaaactagttttt
tcaaaagcaaaaaattcagtagacgattatgttgttaatacagccaattcgaagactttt
gaagtttgggtccctgtaaatattagttatgatgaactagcaaatattgtttcacaaaat
attaacgaaaaagcagaatacctaaaattgtttgctatttatcctaacgaaaagtataat
cttagatcaaactgtattttgaaagattatttgttgagagattataattgctctttgaca
ccaacatttgaatacgaggtgctgtcgatgccattgaaagatttagaaagtctaagatct
attagattatattggttaactgatacttatatacattttcagttatacgacttcaaaata
ccaaatcatttctcagttaaggaattcaaggataagatccaaaataaagttggtttttct
gattctgataagaataatatattgttctggacaaattctaattttaaatttgcaaacgtt
atatttgataataattcatttgatgatgttggtaagggtgttttattatttgctagaatt
ctaccagaggagctaaaattacttcatcatctggataacttagaaaatacggatgagact
gagtcatattcttcaaccaatgaaagcaactcgactactcaagatcacaaaaaacctaat
gatcacttagttgtagtgatgcaatgtttcaagggtatcgagaatagacatggcatttca
tttttatttgatttaagaccaaacgaaaatttgtcagatgcaaaatctagattacataag
aaattcggattgggagaaagagaattcaataaaattaagtttaaccttcttgttcgtact
tatactggtaaggttttgaagtctctccaagatttaactgaagaagaagaacaaaagatt
atattgtataacatcatgggtcatttggatataatttatatggaccatcctgatagattg
aaatcacaatcttcacaagatagaccaatgacgattaaataa

DBGET integrated database retrieval system