KEGG   Tetrapisispora phaffii: TPHA_0M00300Help
Entry
TPHA_0M00300      CDS       T02235                                 

Gene name
TPHA0M00300
Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
tpf  Tetrapisispora phaffii
Pathway
Cell cycle - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:tpf04111]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13:59377..61701
Genome map
AA seq 774 aa AA seqDB search
MVLNDNTRFSKSGGIRNDTIQTYNNDSDSDEKLTVLPKLSNFGSALISEKNENITRNSLT
NSSISMSSNYNQINTLTKNNEIGTINSNFNNGQIASPKFKGIKNLIDQEMTVKHNERRKG
RRIFRKIELNSLGKAKRTNLDYTIAPSHMTEVNYDQYQENDHKTFESMNDMENDIPKYKT
TTDSILSNNKSTDNLAGKNSKNHVTTPSSSFGSTLYSSTTNPFTDSNTYNHSNTSLPNTM
IDYNLIEIGDLNPFQVLKKYNLPSTELATISKLYFEKQKEENRKNIMKKRSVSKEGFMTS
ISSNSVSSKISRQSSFHTTTNNRHSSMVSKQDTNAILMNTTSTRSDEKVMKPLNEYEPDR
KVLASIDINKNINVNAIEKKRPVEHQYSYEKSKIHISESRESQSSTVEKPHTFQDNKEGQ
KIVKKVEIVEPPTSMTNRKSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYAL
KRVVFDEFDDTSVDAFKGEIELLKKLENEKRVVKLIQYQMDNGVLYLVMECGDHDLSQIL
NQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAV
PDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYG
RPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEI
LDASFLNPVLVTPYIVRDLIRNAVYYGSDQGQVSEDKITELADDVLNRLADFRL
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atggtgttgaatgataatactagattttcgaagtcagggggaattcgaaatgatactata
cagacttataataatgattccgattcagatgaaaagttaacagtgttaccaaagttaagt
aactttggatccgcattaatatcagaaaagaatgagaatataacaagaaattcattaacc
aactctagcatatctatgagtagtaactataatcaaattaatactcttacgaagaataat
gaaattggaactataaattctaattttaataacggtcagatagcgtcaccgaaattcaaa
ggaattaaaaatcttatagatcaagaaatgactgttaaacataatgagagaagaaaagga
agaagaatctttaggaaaatagaattaaattccttgggtaaggccaagagaacaaattta
gattacacaatagcaccatcccatatgacagaagttaattatgatcaatatcaagagaac
gaccacaaaacattcgaaagtatgaatgacatggaaaatgacataccgaaatataagaca
acaactgatagtatactaagtaataataaatcaacagataatttagcaggtaaaaactca
aaaaatcatgtcactactccatcatcctcttttggttctacgttatattcatcaactact
aatcccttcacagattccaatacatataatcattcaaatacaagcctaccaaatacaatg
atagattataatttgattgaaataggagacttgaatcctttccaggttttaaaaaaatac
aatttaccatccactgagttagcaactatctcaaaattatattttgaaaaacaaaaagaa
gagaatagaaaaaatataatgaaaaaaagatctgtttcgaaggagggtttcatgacatca
atttcatccaattcagtatcatctaagatttctcgtcaaagttcattccatacaacaact
aataatcgtcatagttcaatggtatccaaacaagatactaatgccattttaatgaataca
acttctactcgttcagatgaaaaagtcatgaaaccacttaatgaatatgaacctgacaga
aaggttttggcatcaatagacataaataaaaatattaatgtcaatgccattgagaaaaaa
agacctgttgaacatcaatattcttatgaaaaatccaaaatacatatctctgaatcaaga
gaatcccaaagttcaactgttgaaaaacctcacacttttcaggataacaaagaaggacaa
aaaatagttaaaaaggttgaaattgtagagcctccaacatcaatgacgaataggaaatct
tctaagagtattgtttcagttaatgacatagaatatgaaagaattgaactactcggaagg
ggtggttcatctaaggtatacaaggttaagaatacaaacaacaatagagtatatgcatta
aagagggttgtatttgatgaattcgatgatactagtgttgatgcattcaaaggggaaatt
gagttattaaaaaagcttgaaaatgaaaaaagagtagttaaattgattcaatatcaaatg
gataatggtgtattatatttggtaatggaatgtggtgatcatgatttatcccaaattctt
aaccagagagctaatatgccattagatgttgattttattcgttattactctcgagaaatg
ttaaaatgtgtcaaagtggttcacgatgcaggcatcgtccactctgatcttaaaccagct
aattttgttttagtgaaaggtatactaaaaattattgattttggtattgccaacgctgta
cctgaccataccgtgaacatttatcgtgatacacagattgggacaccaaattacatggca
cctgaagcgttagtggctttgaacgaagttagtaacgttgaaaaaaagaatagatggaga
gtagggaaaccatcagatatttggtcatgtggatgtatcatgtaccaaatgttttatggt
aggccaccatacggtgcatttcagaatcaaaacagattattagccataatgaatcctgaa
gttaaaatagtattttcagaaaaaacttctaagaatgaaagggtaccaaagtctgctctt
gatacgatgaaggcatgcttgataaggagcccagagaaaaggtggactgcagatgagatc
ttagatgcatctttcctgaaccctgttttagtcactccttatatagtacgtgatttaatc
cgaaatgccgtatattatggttctgatcaaggacaagtatcggaagataaaataacggaa
ctcgcagatgatgttcttaatcgattagcggactttagattgtaa

DBGET integrated database retrieval system