KEGG   Tetrapisispora phaffii: TPHA_0M00340Help
Entry
TPHA_0M00340      CDS       T02235                                 

Gene name
TPHA0M00340
Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
tpf  Tetrapisispora phaffii
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    TPHA_0M00340 (TPHA0M00340)
Enzymes [BR:tpf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     TPHA_0M00340 (TPHA0M00340)
Transfer RNA biogenesis [BR:tpf03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    TPHA_0M00340 (TPHA0M00340)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13:65852..66940
Genome map
AA seq 362 aa AA seqDB search
MAFEKELLVATQAVRKASLLTKRIQGRVIAHKDSSTLIKSDSSPVTIGDYAAQTVIINAI
KSNFPDDKILGEESAAGLKDEFLSEILKEIKENDTIFDESYSTDFKFRSDEYPLKTIDDV
RNVINLGDYKGGRQGRFWCLDPIDGTKGFLRGEQFAVCLGLIVDGTTQVGVLGCPNLSLK
EYGGEKDIEGYEKFGYIFRAVRGQGAFYQPNASDPTDNSHWTTCHVRQLQDAQQMISLEG
VEKAHSSHSEQSEIKREQGITKTLHLDSQAKYCLLALGLGDVYLRLPIKLSFQEKIYDHA
AGNVIVHEAGGIHTDAMENVPLDFGNGLTLSTKGVIASSGPQRLHDAVVSTSESVITSRA
SK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggccttcgaaaaagaattattagtagctactcaagctgttcgtaaagcatctttgttg
actaaacgtatccaaggaagagttattgctcacaaggattccagtacgcttattaagagt
gacagttctccagtaacaattggagactatgcagcacagacagtgattattaatgctatc
aaatctaatttccccgatgataagatcttaggtgaggaaagtgctgctgggttgaaagat
gagtttttgtctgaaattttgaaagagataaaggaaaatgatacaatttttgatgaatcg
tatagtactgatttcaaattccgtagtgatgagtacccattaaagacgattgacgatgtg
agaaatgttattaatttaggggactataaaggtggacgtcaaggcagattctggtgtttg
gatccaatcgatggcactaaggggttccttagaggtgaacaatttgccgtttgtctggga
cttattgttgatggtactactcaagtaggtgttcttgggtgtcctaacttgtcattgaaa
gaatatggcggagagaaggatatcgagggctacgagaagttcggatatatcttccgtgca
gtcaggggccaaggtgcattctaccaaccaaatgcgtcagatccaaccgacaacagccat
tggactacatgccatgtcagacaactgcaagacgcacaacagatgatctcacttgaaggt
gttgagaaggctcactcatcgcatagcgaacaatcggaaatcaagagagaacaaggaatc
accaaaacattacatcttgactctcaagcaaaatactgcctattggcacttggtcttggt
gatgtttacttaaggttaccaatcaaactatcgttccaagaaaagatatacgaccacgcc
gcaggtaacgtgatagtacacgaagctggtggaattcatacagatgctatggagaatgtt
ccattagactttggcaacggcttgactttatcaactaaaggtgtcattgcctccagtgga
cctcaacgtttgcacgacgctgtcgtctccacgtctgaatccgtgatcacctctagagcc
agtaaataa

DBGET integrated database retrieval system