KEGG   Tetrapisispora phaffii: TPHA_0M01090Help
Entry
TPHA_0M01090      CDS       T02235                                 

Gene name
TPHA0M01090
Definition
hypothetical protein
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
tpf  Tetrapisispora phaffii
Brite
Enzymes [BR:tpf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     TPHA_0M01090 (TPHA0M01090)
Peptidases [BR:tpf01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TPHA_0M01090 (TPHA0M01090)
Exosome [BR:tpf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TPHA_0M01090 (TPHA0M01090)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13:complement(217833..220175)
Genome map
AA seq 780 aa AA seqDB search
MTDKLLSTVTVPNIIGKSECIYCFESPFNKTESQSINSVEHSLNTCISCFQAVCRRHLGL
HMNVTNHLCDSPHLSYLEIAKVIKPDSEEEQTLKETGSNKKLKLQVIDKSEDETYNTLWA
LKAYNSINDESANILSTDKDTQVSEESKNIIDKIINAKAQELVDQTTSWELEVKSCSHSR
ALSDQINTQSNNDSNLNQCSSCDLTENLWLCLHCGNVGCGREQVGIDGNSHALKHFETNE
DHPIAIKLGSLSSSSNDVYCYSCNDEVTFDNKEDLSKILLNYGVDLQNKQANEKTLVELQ
VEQNMNWDFKMMDSQGNDLVKLNSNKDLGCGLINLGNSCYMNSVIKVLLNGGIPGWSLDS
IGSSFPMDVVYPSNNLLCQLIKLNIAMKIEPERYPDGIKPTSFKKCITRGNAEFSSGKQQ
DSMEFFTFLTNQLDKKIFKNINKENNPNNLFKFSLEERMQCNNCKAVKYITQTEEHLQLP
LKENQKAQTLTENIENYFNGEEVDFTCPHCTTSTSVLKTPAFKSYPSTLIINPIRIKLEN
LGLIKIDNELNMPGLGNNDYLDLSPYKSKGFNPDSEVLMKDEEESNKFVPNQTSVAQLNE
MGFTLNAVTRALFATGNQDTESAMNWLFQHMEDFDLNEPFTPPVKSKSNDCDPEALNNMI
AMGLYPKLCKKALLLNNHDVNKSVEWVFGNMDDDGELDFNEETTVPDEIIGFDQPASYQL
TAVVCHKGNSVHSGHYVAFIKKNIDNKSNWVLFNDEKIVLAQDTDELKKNGYIYVYTRCS
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgacggataaacttttatcgactgtaacggttcctaatatcatcggtaaaagtgaatgt
atttattgttttgaaagcccatttaacaaaacagaatcgcagtctattaactcagttgaa
cattcattaaacacatgcatttcatgtttccaagcagtttgtagaagacatctaggttta
catatgaatgttactaatcatttatgtgattcgccacatttatcttacttggaaattgct
aaagtgattaaacctgacagcgaagaagaacaaacgctaaaagaaaccggaagcaataaa
aaattgaagttacaagtcatagataaatcagaggatgaaacttataatacattatgggct
ttgaaagcctataactctatcaatgatgaatccgcaaatattttatctactgataaggat
actcaagtaagtgaagagtctaaaaatataatcgataaaataataaatgctaaagctcaa
gaattggtggatcagacaacttcctgggaacttgaggtaaaatcatgttctcattcaaga
gcattaagtgatcagattaatactcaaagtaacaatgattctaatctaaatcaatgttct
tcttgtgatctaacagaaaatttatggttatgtttacactgtggcaatgtcggttgtggt
agggaacaagttggaattgatggaaattcacatgctttgaaacattttgaaacaaatgaa
gatcatcctatcgcaattaaattaggatcactatctagttcttcaaatgatgtgtactgt
tattcatgtaatgatgaagttacattcgacaataaggaagatctaagtaaaatattatta
aactatggtgttgatttacaaaacaaacaagctaatgaaaaaaccttagttgaattgcaa
gttgaacaaaatatgaattgggattttaaaatgatggattcacaaggaaatgacttggtt
aaattaaacagtaataaagatttaggttgcggcttaataaatttgggtaactcttgctat
atgaattctgtaattaaggtgctattaaatggtggtattcctggatggtctttagatagt
attggatcttcttttccaatggatgttgtctatccatccaataatttattgtgtcagtta
ataaaattgaatattgcgatgaaaatagaacctgagcgttatccagatggtattaaacct
acatcctttaagaaatgtattacgcgtggtaatgcagagtttagttcaggaaaacagcaa
gattcaatggaattttttactttcttgactaatcaattagacaaaaaaatattcaaaaat
atcaataaggagaacaacccaaataatttatttaaattttctttggaagaaagaatgcaa
tgtaacaattgtaaagcagtcaaatatattacgcaaacagaagaacatttgcagttgcca
ttaaaagaaaatcagaaagctcaaactttgacagagaatattgaaaactatttcaatggt
gaggaagtagatttcacatgtcctcactgtacaacgtcaactagcgtactcaaaacccca
gcatttaagtcatacccaagtactctaataataaacccaataagaattaaattggaaaat
ttagggttgattaaaattgacaatgaattgaatatgccaggacttggtaataatgattac
ttagatttatctccttataaatcaaagggttttaatcctgacagcgaagttttaatgaaa
gacgaagaagaatccaataaatttgttccaaatcagacatctgtagctcagctgaatgaa
atgggcttcactttaaatgcggtcacaagagcattatttgccactggtaaccaggatact
gaaagtgctatgaattggttattccaacatatggaggactttgatttgaatgaaccgttc
actccaccagtcaaatcgaaatccaatgattgtgatcctgaagcattaaataatatgatt
gcaatgggtttatatccaaagttgtgtaagaaagcacttttactgaataaccatgatgtt
aataaaagtgtcgaatgggtgtttggtaacatggatgatgatggcgaactggactttaat
gaagaaacaacggttcctgatgaaataattggatttgatcaaccagcttcatatcagtta
actgcagtagtttgtcataaaggtaattcagttcattcgggacattatgttgccttcatt
aaaaaaaatattgataataaatctaactgggtattatttaatgatgaaaagattgttctt
gctcaagatactgatgagttgaaaaagaatggttatatttatgtatacaccagatgtagc
taa

DBGET integrated database retrieval system