KEGG   Tetrapisispora phaffii: TPHA_0M01100Help
Entry
TPHA_0M01100      CDS       T02235                                 

Gene name
TPHA0M01100
Definition
hypothetical protein
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
tpf  Tetrapisispora phaffii
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TPHA_0M01100 (TPHA0M01100)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    TPHA_0M01100 (TPHA0M01100)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TPHA_0M01100 (TPHA0M01100)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TPHA_0M01100 (TPHA0M01100)
Enzymes [BR:tpf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     TPHA_0M01100 (TPHA0M01100)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13:complement(220631..222181)
Genome map
AA seq 516 aa AA seqDB search
MLRSVKQKSSLLKNVSTANYRRMINNKPLANIENVMNVPVHFTVKDTARIITLNRPNKLN
ALNTEMSDSIFNTLNEYAKSSATKLIIFNSSNQPRSFCAGGDVATVAIDNLNQKIKDSIK
FFESEYSLNFQIATYDKPIVAIMNGITMGGGVGLAIHAPFRISTENTKWAMPEMDIGFFP
DVGTTFALPRILNISNEKLQMAAYLSLTGEVINGEDAYLMGLSSHYISHENLNSLETRLG
ELLLNEKTGTDSNKENIYKKVNIALEEFSSELPKDYKFKYNNHQLDVIEKVFEIDSKTSI
EKILKNLDDIKNPDEIDFAQEIKSKLLTKSIPSLQVAIRLLQHNSKDNISSALKRDLFTA
ANFCYASKNPDSPIEFTQSVKHKLIEKNKNAYNWKQTAPLDPLQVNSLISPRPSLLTALK
RNTENITWNNYPYHSKFQLPSESIINSYIKKVNETNRATDGDISRSITKKEVVNYFTNYS
DDFKGKNAVDKIASLICEKNFNVDEFNGLISKSKDL
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgttgagatcggttaagcagaaatcaagtttgttaaagaatgtttctacagctaattat
agaagaatgataaataataaaccattagcaaatattgaaaatgttatgaatgtgcctgtt
cattttactgttaaagatacagcaagaattattactttaaatagaccaaataaattaaat
gctttgaatactgaaatgtcagattctattttcaacactttaaatgaatatgcaaagagt
agtgcaacaaaattgattatatttaactcatctaatcaaccgagatctttttgtgctggc
ggtgatgttgctactgttgcaattgataatttaaatcaaaagataaaagattctattaaa
ttttttgaatctgaatattctttaaattttcaaatagctacatatgataaaccaatcgtt
gctataatgaatggtatcacaatgggtggtggtgtcggattagctatacatgctccattt
agaatttccactgaaaatacaaaatgggcaatgcctgaaatggatattgggtttttccca
gatgttggtacaacttttgctttaccaagaattttaaatatttcaaatgaaaagttacaa
atggcagcatatttaagtttaactggtgaagttattaatggcgaagatgcatatttaatg
ggtctttcatcacattatattagtcatgaaaatttgaattctttagagacaagactaggg
gaattattattaaatgaaaagactggtactgatagtaataaagaaaatatttacaaaaaa
gttaatattgcacttgaagaattttcatcagaattgcctaaagattataagtttaaatat
aataatcatcaattagatgtaattgaaaaggtatttgaaattgattcaaagacaagtatt
gaaaaaatattgaaaaatttagacgatattaaaaatccagatgaaattgattttgctcaa
gagattaaatctaaactattaacaaaatcaattccatcattacaagtagctattaggtta
ttacaacataattcaaaagataatatcagtagtgctttgaagagagatctattcactgca
gcaaatttctgttatgcatcaaagaacccagactctccaatcgaatttacacaaagtgtt
aaacataaactaattgaaaaaaataaaaatgcctataattggaaacaaacggcacctcta
gatcctttacaagtcaattctttaatttctcctagaccttcactcttgacagcattaaag
agaaatactgaaaacattacttggaataactatccatatcattcaaaattccaacttcca
agtgaatcaataataaatagttatattaaaaaggtcaatgaaactaatagagcaactgat
ggtgatataagtagaagtattactaaaaaagaagttgtcaactatttcacaaattactca
gacgattttaagggtaaaaatgcagttgataaaattgcatcattaatttgtgaaaagaac
tttaatgttgatgagttcaatggtttgatatcaaaatccaaagacttataa

  All links  
No link information was found.   
DBGET integrated database retrieval system