KEGG   Tetrapisispora phaffii: TPHA_0M01230Help
Entry
TPHA_0M01230      CDS       T02235                                 

Gene name
TPHA0M01230
Definition
hypothetical protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
tpf  Tetrapisispora phaffii
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tpf03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13:252072..255026
Genome map
AA seq 984 aa AA seqDB search
MNNPKFQNKPFKPPRRINTLNHDTTKINVTSDSEINKNGIFKRKSANDTIDTTFQEKKIK
VHKIDDRFPLSRDISSIFATVYRKKTLKKNKVWTNDGFCILKNDNRLNFYDDAGNFISGL
DLKLTTDSLFDELFKIGSLELQIDYKIEDPEETKKTVSIIFGRKADNTINSSSLIKNNST
VESHNDGNSNYVNTNQSKNLLNATTSTTTSDINRKLIASKEIIKSFQTKINNTSKSHLVP
LSQLFAKKTTASFRQILIRSESHTPLTTPSSNISSDNQKIFLPVFDLNKISDPIVMNRSK
DALVDVIVDPILGKLLRPHQREGVKFMYDCMMGLQRPSTTIVKNTDDDGDSTSKSLTLEY
DSDIKGCLLADEMGLGKTLMTITLIWTLLKQTAFPTNVAVSQSGVPLHGAYKKFIIVCPV
TLIGNWKREFGKWLGLSAIGILTLSPKNNSEKDKMDVRNFLKVQRIYQVLIIGYEKILSV
SDDLFENKDKIDMIICDEGHRLKNGSSKILNALKRLDVENKVLLSGTPIQNDLNEFFTII
DFINPGILGSFNHFKKKFITPITRARDVNNRYNEDILSIGSEKSKEMIQITKRFVLRRTN
SLLTKYLPPKNDVILFCKPTDAQLNAFSDIFSVSHFDINNLSFTSSLGLITLFKKICNTP
MLIKSDSYYQSNLRNSSTTLVYENKLDSGKLKVFMSLLDHIRNATDEKVVIVSNYTQTLD
ILENLMRSQNITTCRLDGSTPNKQRDSIVTNFNRNANIFGFLLSSKSGGAGLNLIGASRL
ILFDNDWNPSIDLQAMSRIHRDGQKKTCHIYRLITTGCIDEKIFQRQLMKHSLSQQFLND
QDDNSGSHKNDDLFNKEDLKDLFTIVSDSKCNTHDLICDCDGSTNEDYSISTDDEFEDSK
ETSISSLTSNGWTSALNAQKLLEEREKSEKLEKTKIIKKCLAGYRHIDLTIQNSIEDSIL
EESLPKNLDCVTFAFFKPGKAKSL
NT seq 2955 nt NT seq  +upstreamnt  +downstreamnt
atgaataatcctaaattccaaaataaacctttcaaaccacctagaaggataaatactttg
aatcacgatacaaccaaaataaatgtcaccagcgattctgaaataaataaaaacggcata
ttcaaaaggaaatcagctaatgataccattgatactacttttcaagaaaaaaagataaaa
gtacataaaattgacgatcgttttccattgtcaagagacatctcatcgatatttgccaca
gtgtataggaaaaaaacacttaagaaaaacaaagtttggacaaatgacggtttctgtatt
ctaaaaaatgacaacagactaaacttttacgatgatgctgggaactttatatcaggtctg
gatctcaaattaactactgattctctttttgatgaattattcaagattgggtccttggaa
ttacaaattgattataaaattgaggatcctgaagaaaccaaaaaaactgttagtattatt
tttggaaggaaagctgataatactataaatagtagtagtctaattaaaaataacagcact
gttgaaagccacaatgatggaaatagtaactatgttaatacaaatcaatcaaagaatctt
ctaaatgcaacaacctccactacgacatctgatataaatagaaaattaattgcttcaaaa
gaaattattaaatcatttcaaactaaaatcaataacacttctaaatcacatcttgtccct
ctatcgcaactctttgctaaaaagaccacagcttcatttcgccaaatattaataaggtca
gaatcgcatactcctttgacaacacctagctcaaatatttcgtctgataatcagaaaata
tttcttcctgtatttgatttgaataaaatttctgatcccatcgtaatgaatagatcgaaa
gatgcactagttgatgttatagtagatcccattttaggaaaattattaaggccgcaccag
agagagggtgtgaaattcatgtacgattgtatgatggggttacaaaggccttcaacaact
attgtcaaaaatactgatgatgatggtgattctacttcaaaatcattgaccttagaatat
gattctgatattaaaggttgcttactagctgatgagatgggtttagggaaaactttgatg
acaattacattgatctggactttactaaaacaaactgcatttccaacaaacgttgccgtt
tctcaatcaggagttcccttacatggtgcatacaaaaagttcattattgtttgtcccgtc
acattaattggtaattggaaaagagaatttggtaaatggttggggttgtcagcaattgga
attttaaccttatcgccaaaaaataactctgaaaaagataagatggatgtcagaaacttt
ttaaaggtccaaagaatttaccaagtcttaataattggttacgaaaaaatattaagtgtg
tcagatgatctttttgaaaataaagataaaatagatatgattatttgtgatgaaggtcat
agactaaaaaatggttcttcaaaaattcttaatgctttaaaaagattagatgtcgaaaac
aaagtactgttatcaggaacaccaattcaaaatgatctaaatgaattttttacgattata
gatttcattaatcctggtattttaggttcatttaatcactttaaaaagaaatttataact
ccaataactagagctagagatgtgaacaatcgttacaatgaggatattctatcaatagga
tcggagaaatctaaagaaatgatacagatcaccaagagatttgtattacgaaggacaaat
tcactattgactaaatacttacctccaaagaatgatgtgattctgttctgtaaacctaca
gatgctcagctaaatgctttttccgatatattttcggtttcccatttcgatatcaataat
ctgagttttacatcatcattgggtttgataactttgtttaagaaaatctgtaacacacca
atgttaataaagtcagattcatattatcaatctaacttgagaaattcatcgacaacattg
gtgtatgaaaataaactagattcgggaaaattaaaagtttttatgagtttattggatcat
attagaaatgctactgatgaaaaggtcgtaattgtatctaattatacccagacattggat
attcttgaaaacttaatgcgatcccaaaatattacaacctgtcgtttagatggttcaact
ccaaataagcaaagagattctattgtaacaaactttaatcgaaacgctaatatttttggg
tttcttcttagttcgaaatctggtggtgccggtttaaacttaattggtgcatcgcgactg
attttatttgataatgattggaatccttcgattgatttacaagctatgtcaagaattcat
agagatggtcaaaaaaaaacatgccatatatatagattgattacaactggttgcatcgat
gaaaagattttccagagacaactaatgaaacatagtttaagccaacaatttttaaatgat
caagatgacaattcgggcagtcataaaaatgatgatttatttaacaaagaagatttaaag
gatttatttacaattgtatcagactcaaaatgtaacacccatgacctaatatgtgattgc
gatggatcaactaatgaagattacagtatttcgaccgatgatgagttcgaagatagcaaa
gaaacttctatatcatcactcacttctaatggatggactagtgctctaaatgctcaaaaa
ttgttagaggagagagaaaaatctgagaaactagaaaaaacaaagattatcaaaaaatgt
cttgcaggctacagacatattgatttaactattcaaaatagcattgaagatagcatatta
gaagaatcgttaccgaaaaatcttgattgtgtaacttttgcattctttaaaccaggaaaa
gcaaaaagcttatag

DBGET integrated database retrieval system