KEGG   Tetrapisispora phaffii: TPHA_0M01500Help
Entry
TPHA_0M01500      CDS       T02235                                 

Gene name
TPHA0M01500
Definition
hypothetical protein
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
tpf  Tetrapisispora phaffii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13:317999..319291
Genome map
AA seq 430 aa AA seqDB search
MNNLIGDGARGSINNYFYKTKLELPLYDIKNSKKPTEQIEGPRVPRTIHESSKVSLPQRY
EVVQVLGKGSYGIVCSVRDLNSNTNNALLAVKKITNIFYKEILIKRAIRELKFIKYFRGH
KNIVSLLDVDIVLDAPYDGLYCYQELIDYDLAKVVHSSVLLTEFHIKYFFYQILCGLKYI
HSADVLHRDLKPGNILCTLNGTLKICDFGLARGISQTVLQKANRQNSTNEPVQYYNLDIT
NYVATRWYRAPELILSHNEYDKSIDIWSCGCILAEFYGRKPVFMGKDAMHQIFEIIKVIG
SPSKELLETYGSSKSWTVYNSNMINYKKKEWSEVYPHATAQATDLMENLMKWVSKDRYTV
EEAIEHPFLSDVRNKDDEPICPYGEFDFLYEYELHSMQDLRNYLVNEVNTFKSEKKIIFN
KSHSRSQMTI
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatctaattggcgatggggctagagggtctataaacaactacttctataagact
aaactggagcttccattatacgatattaaaaattcgaagaagcctactgagcaaatcgaa
ggtcctagggttccaaggacaatacatgaaagttcaaaagttagcttgcctcaaagatac
gaagtggttcaagttttaggaaagggttcatatggaatagtttgctcagttagggacctg
aatagcaatacaaacaatgccttattggcagttaagaagataacaaatattttttataag
gagattttaataaagagggccatccgagaattgaaattcatcaaatattttagaggacat
aagaatatcgttagtcttctggatgtcgatatcgtattagatgccccgtatgatggacta
tattgttatcaagaacttattgactatgacctggcaaaagttgtccattcttctgtgctg
ctgacggagtttcatatcaagtatttcttttatcagatcttgtgtggtctcaagtatatc
cactccgcagatgtacttcatagagacttgaaaccgggaaatatactatgtacactaaac
gggacgttaaagatatgcgattttggcttagcaagaggaatatcacaaactgttctacag
aaagctaacagacaaaattcgacaaacgaaccagttcagtattacaatctggatataacg
aactatgtggccactagatggtacagagctccagaattgatactgtcgcacaacgagtac
gataagtctatagatatttggtcgtgtggatgcattcttgccgaattctatggtcgaaaa
cccgtgttcatggggaaagacgccatgcatcaaatattcgaaattattaaagtaattggg
tctccatccaaagagttattagaaacatatggctcgtcgaaatcttggacagtgtacaat
tcgaatatgatcaactataaaaagaaagagtggtctgaagtttatccacatgcaaccgcc
caagccactgatctaatggaaaatttaatgaaatgggtttcaaaagacaggtacacagta
gaggaagcaattgaacacccgtttttatcagacgtgagaaacaaagatgacgaacccatt
tgtccttatggagaattcgattttttatacgagtacgagttgcattcgatgcaagatcta
aggaattatcttgttaatgaagtcaacaccttcaagtcagaaaagaaaataatattcaat
aaatcccactctagatcacaaatgacaatttaa

DBGET integrated database retrieval system