KEGG   Tetrapisispora phaffii: TPHA_0N00220Help
Entry
TPHA_0N00220      CDS       T02235                                 

Gene name
TPHA0N00220
Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tpf  Tetrapisispora phaffii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TPHA_0N00220 (TPHA0N00220)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TPHA_0N00220 (TPHA0N00220)
   00620 Pyruvate metabolism
    TPHA_0N00220 (TPHA0N00220)
   00640 Propanoate metabolism
    TPHA_0N00220 (TPHA0N00220)
  Energy metabolism
   00680 Methane metabolism
    TPHA_0N00220 (TPHA0N00220)
Enzymes [BR:tpf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TPHA_0N00220 (TPHA0N00220)
Lipid biosynthesis proteins [BR:tpf01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TPHA_0N00220 (TPHA0N00220)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14:complement(35883..38036)
Genome map
AA seq 717 aa AA seqDB search
MIAVSDTTDNSIVENVENLEIASNDPVAIKEQNQTQTTESKTEYEHLTNVQIIQQKSIEN
RLEFSNGYKPNIKNFDQYKELYDQSINNPKVFFNEMASKNLDWFKPYDQVFIEDSNDSSK
PSFQDNSWFLNGQLNACYNCVDRHALKTPNKIAIIYESDEPGKDSYTLTYKELLSEVSKL
AQVLTYSMNVKKGDTVAVYMPMIPQALITLLAISRVGAIHSVIFAGFSSNSLKDRIIDAN
SKCVITTDESLRGGKVIETKRIVDDAVKEAKIVENVLVYKRTNNPNVSYVENRDLDWELE
MKKYKSYFPCVPVDSEDPLFLLYTSGSTGTPKGVQHSTAGYLLGALMTTKYVFDVNPNDI
LFTAGDIGWITGHTYVVYGPLLNGCTTVVFEGTPAYPNYSRYWDIVDKYKVTQFYVAPTA
LRLLKRAGNSFIDGYSLKSLRALGSVGEPIAAEVWEWYSEQIGKNEIPICDTYWQTESGS
HLVTPLAGGITPMKPGSASFPFFGIEPVILDPTTGKEVVGEHAEGVLAIKRPWPSFARTI
WKNHDRYLDTYLNPYPGYYFTGDGAARDRDGYIWILGRVDDVVNVSGHRLSTAEIEAAII
EDSIVAECAVVGFNDDLTGQAVAAFVVLKNKTSWSTASEEELLEIKKHLVLTVRKDIGPF
AAPKLIVLVDDLPKTRSGKIMRRILRKILAGESDQLGDVSTLSNPGVVKHLIDSVKL
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgattgcagttagtgacactactgataacagtattgtggaaaatgttgaaaatttagag
atcgccagtaacgatccagttgccattaaggaacaaaatcaaactcaaacaacagagtca
aaaactgagtatgaacatttaacgaatgttcagataattcagcaaaaatcgattgaaaat
agattagaattttcaaatggctataaaccaaatataaaaaatttcgatcaatataaggaa
ttatacgatcaatcaattaataatccgaaagtcttttttaatgaaatggcttcaaaaaat
cttgactggtttaaaccatacgatcaggtattcattgaggattcaaatgattcatcaaaa
ccttcctttcaagataattcatggttcttgaatggtcaattgaacgcctgttataattgt
gtcgacagacacgctttaaagacaccaaacaaaattgcaattatttatgaaagtgatgag
cctggaaaggactcgtatactttgacttacaaagagttattatccgaagtttcaaaatta
gcccaagttcttacttattcaatgaacgttaaaaagggggatacagtagctgtttacatg
cccatgattccgcaagcattgattacattattagctatttcaagagtcggcgcaattcat
tccgtcattttcgcaggcttttcctctaattctttaaaagatagaatcatcgacgcaaac
tcaaaatgtgtcattaccactgatgaatctttaagaggtgggaaagttattgaaacaaaa
agaattgtagatgatgcagttaaagaagctaaaattgtggagaatgttttggtttacaag
agaacaaataatccaaatgttagttacgttgaaaatagagatctggattgggaattggaa
atgaaaaagtataagtcttatttcccttgtgttccagttgatagtgaagatccattattc
ttattatacacttcaggttctacaggtactccaaaaggtgttcaacattcaactgcaggt
tatttattaggtgcattaatgacaacaaagtatgtatttgatgtcaatccaaatgatatt
ttattcacagctggtgatatcggttggatcactggacatacttacgttgtatatggtccg
ttattaaatggttgcactaccgtagtcttcgaaggtactccagcttatccaaattattca
aggtactgggatattgttgataagtataaggtaacacagttttatgttgctccaacagct
ttaaggttattgaaaagggcaggcaattcattcattgatggttattcattaaaatcatta
agagcgctaggttcagttggtgaaccaattgcagcagaagtctgggaatggtatagtgaa
caaataggtaaaaatgaaattcctatctgtgacacttattggcaaactgaatcaggttcc
catttagttactcctctagctggaggaatcacaccaatgaaaccgggatctgcatcattc
ccatttttcggcattgagccagtcattttagatcctacaacaggtaaggaggtagttgga
gagcatgccgaaggtgtcctggctattaagagaccttggccttcatttgcaagaactatt
tggaaaaaccatgacagatacttagatacttacttgaacccatacccaggttattatttc
acaggtgatggtgcagccagagatcgtgacggttacatttggatcttaggacgtgttgat
gatgtggttaatgtatcaggtcataggttatcgacagcagaaatcgaagctgctattatt
gaagactcgattgtggctgaatgtgctgttgtcggcttcaatgacgacttaactgggcaa
gcagttgctgcctttgtggtcttaaagaataagactagctggtcaactgcttcggaagag
gaactgcttgaaattaagaaacatttggtgttaacagtaagaaaggacattggtccattt
gccgctccaaaattgattgttttagtggatgacttaccaaagactagatcaggaaaaatc
atgagaagaattttaaggaagattcttgcaggtgaatcagatcaattgggtgatgtctca
actttgtctaacccaggtgtcgtcaagcacttgattgactccgttaagttatga

  All links  
No link information was found.   
DBGET integrated database retrieval system