KEGG   Tetrapisispora phaffii: TPHA_0N00250Help
Entry
TPHA_0N00250      CDS       T02235                                 

Gene name
TPHA0N00250
Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
tpf  Tetrapisispora phaffii
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    TPHA_0N00250 (TPHA0N00250)
Translation factors [BR:tpf03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    TPHA_0N00250 (TPHA0N00250)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14:45466..47649
Genome map
AA seq 727 aa AA seqDB search
MSAAFEEIRLEDIPVDDIDFSDLEKEYDVVEKFSFNQYVVVTGAPVIPESKVAVLKKALT
GLFSKAGEVVDMEFPIQDGKTKGFLFVECASPADSTKIIKAYNGKRLDLKHRLFLYTMKD
VEKYTSETFNTEMQEPVLPEFFPSSALKSWLENGSCRDQYVVQNSDLTTIMWNTQMEDDP
DALVERRSKWSTNYVRFSPKGTYLFTYHPQGVVMWGGPKFDRLRRFYHPNVRTSSVSPTE
KYLVTYSSDPIVVDNEDPECPFSTKNEGHQLCIWDISTGLLLVTLPVTTSVQLQWPIVRW
SYNDEYCARLSGDRLVVHDVKKKFAPIDSKALTTTGIRDFSFAPTGVKLAPFRSTDEPSV
LLSYWTPETNNMSCKATIVEVPRGRVLKTVNLVQVSNVTLHWQDNSEFICFNVERHTKSK
KTLFSNLEICKLTEKDIPGEKIELKDTVIEFQWEPHGKRFVAIAAHDTGDDNPAIPRNII
MFFAPEKKDPKDKTNTVKKWVEVASISDRFSNTVAWSPAGRFVTVATLVKATVRRSDFSF
YDMDYTGESTINKVDNASANISNIGKSTFSSATDLEWDPSGRWLAVWSSSLKHKNENGFK
IFNIAGKVIKDEPIPNFKHFAWRPRPASLLTNGEKKKIRTNLREWSAQFAEQDAMEADVA
TRELILRQRELLKEWNAYRASTESHFENSFGYKPFDMVDLHTPDSAFISIEEVKEEIVEQ
TEENVTE
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgcctttgaagaaattagattagaagatatccctgtggatgatatcgatttt
tccgacttggaaaaagaatatgatgttgttgaaaaattttcttttaatcaatatgtcgtt
gtgactggtgctccagttattcctgaatcaaaagttgctgttttgaagaaggccttgact
ggtcttttctcaaaagcaggtgaagttgttgacatggaatttcctattcaagacggtaag
actaaagggttcttattcgtggaatgtgcttctcctgccgacagtaccaagattattaag
gcttacaatggtaagagattagatttgaagcatcgcttgttcttatacaccatgaaggac
gttgaaaaatacacttctgaaactttcaacactgaaatgcaagaacctgttttacctgaa
ttcttcccttcaagtgctttgaaatcctggttggaaaatggttcctgtagagatcaatat
gttgtccaaaacagtgatttaactactattatgtggaacactcaaatggaagacgatcca
gatgctttggttgaaagaagaagcaaatggtccactaactatgttagattttctccaaag
ggtacttacttatttacttaccatccacaaggtgttgttatgtggggtggtccaaaattt
gaccgtctaagaagattttaccatccaaacgtcagaacttcttctgtttctcctactgaa
aagtatttagttacttattcatccgacccaattgttgtcgataacgaagatccagaatgt
ccattcagcaccaaaaatgagggccatcaattatgcatctgggacattagcaccggtcta
ttgttggttactttaccagttaccacaagcgttcaattacagtggccaatcgtcagatgg
tcttacaacgatgaatactgtgccagattaagtggtgatagattagttgtacatgatgtt
aagaagaagttcgctccaattgacagtaaagctctaactaccactggtattagggacttt
tcgtttgctccaactggtgtcaaacttgctccattcagaagtaccgatgaaccatccgtt
ttattatcttactggactccagaaacaaataacatgtcctgtaaggccaccatcgtggaa
gttcctcgtggcagagtcttgaagactgttaacttagtccaagtttccaatgttactttg
cactggcaagacaatagtgaattcatatgtttcaatgttgaacgtcatactaaatctaag
aaaactttattcagtaatttagaaatttgtaaattaactgaaaaggatattccaggtgaa
aaaattgaattaaaggacacagttattgaatttcaatgggaaccacatggaaaaagattt
gttgctatcgctgctcatgatactggtgatgacaacccagccattccaagaaatatcatt
atgttctttgccccagaaaagaaagatccaaaggacaaaactaatactgttaagaaatgg
gttgaagtcgcttctatctcagatagattctccaacactgttgcatggtcaccagctggt
agattcgttactgttgctactttagttaaagcaaccgttcgtagatccgacttttctttc
tacgacatggactacactggagagtctaccattaataaggtcgacaatgcttctgctaac
atcagtaatattggtaaatctacttttagttctgctactgatctggaatgggatccatct
ggtagatggttagctgtctggtccagttctctaaagcacaagaatgaaaatggtttcaag
atctttaacattgctggtaaagttattaaagatgaaccaattccaaacttcaaacatttt
gcttggagaccaagacctgcttcattattaacaaatggtgaaaagaagaagatcagaacg
aacttgagagaatggtctgctcaatttgctgaacaagatgctatggaagctgatgttgct
accagagaattaatcttgagacaacgtgaattattaaaggaatggaacgcatacagggca
tctactgaatctcacttcgaaaactcctttggttacaaacctttcgacatggttgactta
catactcctgacagtgctttcatttccattgaagaagttaaggaagaaattgtggaacaa
accgaagagaatgtcaccgaataa

DBGET integrated database retrieval system