KEGG   Tetrapisispora phaffii: TPHA_0O01130Help
Entry
TPHA_0O01130      CDS       T02235                                 

Gene name
TPHA0O01130
Definition
hypothetical protein
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
tpf  Tetrapisispora phaffii
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TPHA_0O01130 (TPHA0O01130)
Enzymes [BR:tpf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     TPHA_0O01130 (TPHA0O01130)
Glycosyltransferases [BR:tpf01003]
 Polysaccharide
  Storage polysaccharide
   TPHA_0O01130 (TPHA0O01130)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15:complement(219435..221573)
Genome map
AA seq 712 aa AA seqDB search
MGRDLENQLLFEVATEVANKVGGIYSVLKSKALVTIAQYHDNYTLIGPLNRATYQTEVEE
LDWENMHSHDSDSTASIKKVLIRMSERGVRFVYGNWLIEGSPKVILFELNSLSGYLNEWK
ADLWNLVGIPSPENDNETNDAILLGYVVTWFLGELAYINESDTIIAHFHEWLAGVALPLC
RKRRIDVVTIFTTHATLLGRYLCASGDVDFYNNLQNFDVDHEAGKYGIYHRYCIERAAAH
SADVFTTVSHITALEAEHLLKRKPDGILPNGLNVKKFQAYHEFQNLHALKKEKINDFVKG
HFHGSLDFEIDDTLYFFIAGRYEYKNKGVDMYIEALARLNYRLKVSGCKKTVVAFIIMPA
KNNSFTVEALRGQAVVKSLENTVNEVTELIGKRIFDHALKYPHMGITTELPTTLEDLLTD
SDKILLKKRTLNLRRADGELPPVVTHNMADNSSDPVLNKIRSVQLFNNSSDRVKMIFHPE
FLNANNPILGLDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNVSGFGAYMED
LIEANQAKDYGIYIVDRRFKNPEESIEQLVDYIEDFVNKNRRQRINQRNRTERLSDLLDW
KRMGLEYIKARQLALFRAYPDEFKNQISQSTKMTEDSNLDSMTGETKFKISRPLSVPGSP
KNSVIKTPNGNNDIRTVFMTPGDLGTLQDANNADDYFHLGLNDDDDDDGSTY
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgtgatctagaaaatcagttgctttttgaagtagctactgaagtagcaaataag
gtgggtggtatatattcggttttgaaatcgaaagcattggtcactattgctcaatatcat
gataactatactttgattggccctttgaacagagctacttatcaaactgaggtggaagaa
cttgattgggaaaatatgcattctcatgattcagactcaacagcttccattaagaaagtt
ttaataaggatgagtgaaaggggtgttcgctttgtgtatggtaattggttgatagaaggt
tctccaaaagtaatcttatttgaattgaattctctttcaggttatttgaatgaatggaag
gcggacctttggaatttggtcggtattccttctcctgaaaatgacaatgagactaatgat
gcaattttgcttggttatgttgtgacttggtttttaggggaattggcatatataaatgag
agcgatacaattattgcacatttccacgaatggttggcaggtgtggcattacccttgtgt
agaaaaaggagaatagacgttgtcaccatctttactacacatgcaactttattaggaaga
tatttgtgtgcttcaggggatgttgatttctataataatttacaaaactttgatgtcgac
cacgaggcaggcaaatatggcatttatcatcgttactgtatcgaaagagcagccgctcat
agtgccgatgtttttactactgtgtcgcatatcactgctttagaagctgaacatttatta
aaaagaaaacctgatgggatattaccaaatggtttaaacgtaaagaagttccaagcttat
catgagtttcaaaaccttcatgctttgaagaaagaaaagataaatgattttgttaaagga
catttccatggttctttggattttgaaattgatgatactttatattttttcattgctggt
agatatgaatacaaaaataaaggtgttgacatgtatattgaagccttagcaagattgaat
tatagattgaaagtttctggttgtaagaaaactgtcgttgcttttataatcatgcctgcc
aaaaacaattctttcactgtagaagcgttgagaggccaagcagttgtcaaatcgttagaa
aataccgtaaatgaagtaacagagcttattggtaaaagaatttttgatcatgccttgaaa
tatccacatatgggcattacgacagagttaccaacaactttagaagatttattgacggat
tctgataaaattttattgaaaaagagaaccttaaacttaagaagggctgatggagaacta
cctcctgtggttactcataatatggcagataattctagtgatcctgttttaaacaaaatt
agaagtgttcagttatttaataattccagtgatagagttaaaatgattttccatcccgaa
tttttaaatgcaaacaatccaatactaggccttgattatgatgagtttgttcgtggttgt
catttaggtgttttcccttcatattatgaaccttgggggtatacaccggcagaatgtacc
gttatgggtgttccctctataactacaaacgtatctggatttggcgcgtacatggaagac
ttaatagaagcgaaccaggctaaagattatggtatatatattgttgatcgtcgttttaag
aatccagaagaaagtattgaacaactagttgactatatagaagattttgtaaacaaaaat
agaagacaaagaattaaccaaagaaatagaacagagcgactaagtgatcttttggattgg
aagagaatgggcttagaatacattaaagctcgtcaattagcattatttagagcctatcct
gatgaatttaaaaatcaaatatcgcaatcgaccaagatgacggaagactctaatttagat
tcaatgactggagaaacaaaattcaaaatttctagacctttaagcgttccaggatctccc
aagaatagtgtgatcaaaacaccgaatggaaacaatgacataagaacagtatttatgacg
ccaggtgatttgggaacgttgcaggatgcaaacaatgccgatgattacttccatttaggt
ttaaatgatgatgatgatgatgatggatcgacatattaa

DBGET integrated database retrieval system