KEGG   Tetrapisispora phaffii: TPHA_0P01430Help
Entry
TPHA_0P01430      CDS       T02235                                 

Gene name
TPHA0P01430
Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
tpf  Tetrapisispora phaffii
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    TPHA_0P01430 (TPHA0P01430)
   03420 Nucleotide excision repair
    TPHA_0P01430 (TPHA0P01430)
   03430 Mismatch repair
    TPHA_0P01430 (TPHA0P01430)
   03440 Homologous recombination
    TPHA_0P01430 (TPHA0P01430)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
16:complement(294189..294983)
Genome map
AA seq 264 aa AA seqDB search
MATYQAYTEFSTGGGFDNSDSRIGSSDGEVKRTNTLTPVTIKQILESKPLVQDGPFVIHN
QELHSICFVGVIRNISDQTQSIFLTIEDGTGQIEVRKWSEDANDLAAGDEDKNGAQDSQL
SKQHEIGSYVIVYGALKEFGGKKNVQYAVIKNIKSFNEVIAHHLEVIKSHAIANGKMKGV
GASNDQGQQLFVTEGSDAGAPLQRILDFCKEQCTGKDPNSFAVAIQLMTQTLNLDETVVR
ECCNTLTEQGYIYPTFDDNSFFAL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggcaacatatcaagcttacactgaattctccactggtggcggctttgataattcagat
tctagaattggttcatccgatggtgaagttaaaagaaccaacactttaactcctgtaact
attaagcaaatattggaatcaaaaccgctggtccaagacggcccttttgtgattcataat
caagaactacattcaatttgttttgttggtgtaattagaaatatctcagatcaaacacag
agtatttttttaaccattgaagatggtactggccaaatagaagttagaaaatggagtgag
gatgcaaatgacttggccgctggagatgaagataaaaatggtgctcaggactcgcaacta
tctaaacaacatgaaattggttcatacgtaattgtttatggtgctttaaaagaatttggt
ggtaaaaagaatgttcaatacgccgtaatcaagaatattaaatcattcaatgaggttata
gcacatcatttagaagtaatcaaatcgcatgccatagcaaatggcaaaatgaagggagtc
ggtgcatcaaatgatcaaggtcaacaactgtttgttacagaaggttctgatgctggcgct
ccattacaaagaattttagatttctgtaaagagcaatgtactggtaaagaccctaattca
tttgcagttgccattcaactgatgacacaaacattgaaccttgatgaaactgtggtaagg
gaatgttgtaatacgttgactgaacaaggttacatatatccaacatttgacgacaacagt
ttcttcgctttgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system