KEGG   Treponema pallidum subsp. pertenue Gauthier: TPEGAU_0543Help
Entry
TPEGAU_0543       CDS       T01750                                 

Gene name
ruvA
Definition
crossover junction endoribonuclease subunit A
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tpg  Treponema pallidum subsp. pertenue Gauthier
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tpg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TPEGAU_0543 (ruvA)
Enzymes [BR:tpg01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     TPEGAU_0543 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(586939..587622)
Genome map
AA seq 227 aa AA seqDB search
MFESISGILTLHERERLCVEVHGIEWEIAVSAYSSAAFGEVGSHVKVFTWLYHREDALRL
FGFSNVQERTLFLSLTKVEGIGPKQALKVLSSISSQALCAALDTGDLCALQRIPGIGKKT
AQRMLLALKGTLALTDAASCAQSQTDDRAAHPSNLGCAPHAREIEDLVTALVQMGYDRKM
AAEVIAQESAALCSVGRSLYEEEATVLKRAILALSIAHPHAVAPAAE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaaagcatcagcggtatcttgacgctccatgagcgcgagcgcctctgtgttgag
gtgcatggtattgaatgggaaattgcagtgtccgcatacagtagtgctgcgttcggtgag
gttggatcacacgttaaggtctttacctggttgtatcaccgtgaagatgcgcttcgcctc
tttggtttttcgaatgtacaagagcgcacgctctttctcagtcttacaaaggtagaaggt
attggtccaaagcaggcgctcaaagttctttcgagtattagcagtcaggctttgtgtgca
gcgcttgatacaggagatttatgtgcactccagcgcataccaggcattggaaaaaagact
gcacagcgcatgctcttagcgctgaaaggtacgctcgcgctaaccgacgcggcctcttgt
gcccagagtcagacagatgatcgtgctgcacatccgagcaatcttgggtgtgctccccat
gcgagggaaattgaggatctggtaactgctcttgtacagatgggatacgacaggaaaatg
gcggcggaggtgatcgcacaggagagcgctgcgttgtgcagtgtggggcgttcactgtat
gaagaagaagcgacggttcttaaacgtgctattcttgcgttgagtattgcgcatccacac
gcggtcgcgcctgctgcagagtga

DBGET integrated database retrieval system