KEGG   Treponema pallidum subsp. pallidum Chicago: TPChic_0108Help
Entry
TPChic_0108       CDS       T01868                                 

Definition
(GenBank) 6-phosphofructokinase 3 (Phosphofructokinase 3)(Phosphohexokinase 3)
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tph  Treponema pallidum subsp. pallidum Chicago
Pathway
tph00010  Glycolysis / Gluconeogenesis
tph00030  Pentose phosphate pathway
tph00051  Fructose and mannose metabolism
tph00052  Galactose metabolism
tph00680  Methane metabolism
tph01100  Metabolic pathways
tph01110  Biosynthesis of secondary metabolites
tph01120  Microbial metabolism in diverse environments
tph01130  Biosynthesis of antibiotics
tph01200  Carbon metabolism
tph01230  Biosynthesis of amino acids
tph03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:tph00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TPChic_0108
   00030 Pentose phosphate pathway
    TPChic_0108
   00051 Fructose and mannose metabolism
    TPChic_0108
   00052 Galactose metabolism
    TPChic_0108
  Energy metabolism
   00680 Methane metabolism
    TPChic_0108
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    TPChic_0108
Enzymes [BR:tph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TPChic_0108
Protein phosphatases and associated proteins [BR:tph01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TPChic_0108
Messenger RNA biogenesis [BR:tph03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     TPChic_0108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ADD72261
Position
complement(122289..123674)
Genome map
AA seq 461 aa AA seqDB search
MAHLPKEYDFSIESLGESKIPSPIYLSHTLGDFIPNYVSDNEYISHELSARLGETVGPFT
HKNLMERAGPRQKIFFNPHHVHAGIVTCGGLCPGLNDVIRAIVRCLWGRYGVKRISGIRF
GYKGLLPDYNFDILPLTPEVIDNCHKTGGSLLGTSRGGGNRVVDIVDGIERLNLHILFII
GGDGSQKGAKEIADEIKHRNLKISIIGIPKTVDNDISFVQKSFGFDTAIVKATEAVAAAH
MEARSQINGIGLVKLMGRESGFIATYTAIASHETNFVLIPEVSFDLDGPNGLLAHLEKRI
ALRKHAVLVVAEGAGQDLMVNADGVPSGDSQGGSLRVSSGTDASGNKRLADIGLFLKEKI
GVYFKEKRIHINLKYIDPSYLIRSAVAAPIDSIYCERLGNNAVHAAMCGKTKMIIGLVHN
KFVHLPIDVVVCQRKHVNPEGSLWRDALDATGQPIVMKNII
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggcacatcttcctaaagagtacgatttttctatagagtcattgggggaaagcaaaatt
ccctctcccatctacctgtctcacacccttggcgacttcattcctaactacgtcagtgac
aatgagtacatcagccatgaactgagtgcgcgtctgggggagacggtagggccctttact
cataaaaacttgatggagcgtgcgggcccgcgccagaagattttcttcaacccgcatcac
gttcatgcaggtattgtcacctgtggagggctctgtcccggcctcaacgatgtcattcgc
gccatcgtccgctgcctttggggccgctatggcgttaagcgcattagtggtatccgcttt
ggctataagggcctcttgcccgattacaacttcgatatcctgccgctcacccctgaggtc
atcgataactgccacaaaacaggtggttcgctgctaggcacctcgcgcggtggggggaac
cgtgtggttgacatcgtcgatggtatcgagcggctcaacctgcacattctctttatcatt
gggggggatgggagtcagaagggagcaaaagagattgccgacgaaataaaacaccgcaac
cttaagatttccatcatcggcattcccaaaacggtggacaacgacatctcttttgttcaa
aagtcatttggcttcgatactgctattgtcaaagcaacagaggcagttgccgcagcgcac
atggaggctcgttcacagattaacggcattggactggtcaaactcatggggcgtgagtct
ggattcatcgctacgtacacggcgattgcgagccatgagacaaacttcgtactcatccct
gaagtgagctttgaccttgacggtccaaatgggcttttggctcacctagagaagcgaatc
gcgctacgtaagcatgcggtgctcgttgtagcagaaggtgcggggcaagacctaatggta
aatgcggacggtgtgccctccggtgattcccaaggaggtagtttgcgcgtgagcagcggc
acggatgcgtcgggtaacaagcgccttgcggatatcggtttgttcttaaaagaaaagatt
ggagtctatttcaaagaaaagcgtatacacatcaatttaaagtacatcgatccgagctac
ttgattcgttccgcggttgctgcgcccatagattcgatttactgcgaacgcctcggtaac
aatgcggtgcatgcggcgatgtgcggtaaaacgaaaatgatcattggcttggtgcacaat
aagtttgtacacctcccaatcgatgtggtggtgtgccaacgcaaacacgtaaatcctgaa
ggatcgttgtggcgcgacgcccttgatgcaacaggacagccgattgtgatgaaaaatatt
atctag

DBGET integrated database retrieval system