KEGG   Treponema pallidum subsp. pallidum Chicago: TPChic_0108Help
Entry
TPChic_0108       CDS       T01868                                 

Definition
6-phosphofructokinase 3 (Phosphofructokinase 3)(Phosphohexokinase 3) (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tph  Treponema pallidum subsp. pallidum Chicago
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TPChic_0108
   01230 Biosynthesis of amino acids
    TPChic_0108
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TPChic_0108
   00030 Pentose phosphate pathway
    TPChic_0108
   00051 Fructose and mannose metabolism
    TPChic_0108
   00052 Galactose metabolism
    TPChic_0108
  Energy metabolism
   00680 Methane metabolism
    TPChic_0108
Enzymes [BR:tph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TPChic_0108
Protein phosphatases and associated proteins [BR:tph01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TPChic_0108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(122289..123674)
Genome map
AA seq 461 aa AA seqDB search
MAHLPKEYDFSIESLGESKIPSPIYLSHTLGDFIPNYVSDNEYISHELSARLGETVGPFT
HKNLMERAGPRQKIFFNPHHVHAGIVTCGGLCPGLNDVIRAIVRCLWGRYGVKRISGIRF
GYKGLLPDYNFDILPLTPEVIDNCHKTGGSLLGTSRGGGNRVVDIVDGIERLNLHILFII
GGDGSQKGAKEIADEIKHRNLKISIIGIPKTVDNDISFVQKSFGFDTAIVKATEAVAAAH
MEARSQINGIGLVKLMGRESGFIATYTAIASHETNFVLIPEVSFDLDGPNGLLAHLEKRI
ALRKHAVLVVAEGAGQDLMVNADGVPSGDSQGGSLRVSSGTDASGNKRLADIGLFLKEKI
GVYFKEKRIHINLKYIDPSYLIRSAVAAPIDSIYCERLGNNAVHAAMCGKTKMIIGLVHN
KFVHLPIDVVVCQRKHVNPEGSLWRDALDATGQPIVMKNII
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggcacatcttcctaaagagtacgatttttctatagagtcattgggggaaagcaaaatt
ccctctcccatctacctgtctcacacccttggcgacttcattcctaactacgtcagtgac
aatgagtacatcagccatgaactgagtgcgcgtctgggggagacggtagggccctttact
cataaaaacttgatggagcgtgcgggcccgcgccagaagattttcttcaacccgcatcac
gttcatgcaggtattgtcacctgtggagggctctgtcccggcctcaacgatgtcattcgc
gccatcgtccgctgcctttggggccgctatggcgttaagcgcattagtggtatccgcttt
ggctataagggcctcttgcccgattacaacttcgatatcctgccgctcacccctgaggtc
atcgataactgccacaaaacaggtggttcgctgctaggcacctcgcgcggtggggggaac
cgtgtggttgacatcgtcgatggtatcgagcggctcaacctgcacattctctttatcatt
gggggggatgggagtcagaagggagcaaaagagattgccgacgaaataaaacaccgcaac
cttaagatttccatcatcggcattcccaaaacggtggacaacgacatctcttttgttcaa
aagtcatttggcttcgatactgctattgtcaaagcaacagaggcagttgccgcagcgcac
atggaggctcgttcacagattaacggcattggactggtcaaactcatggggcgtgagtct
ggattcatcgctacgtacacggcgattgcgagccatgagacaaacttcgtactcatccct
gaagtgagctttgaccttgacggtccaaatgggcttttggctcacctagagaagcgaatc
gcgctacgtaagcatgcggtgctcgttgtagcagaaggtgcggggcaagacctaatggta
aatgcggacggtgtgccctccggtgattcccaaggaggtagtttgcgcgtgagcagcggc
acggatgcgtcgggtaacaagcgccttgcggatatcggtttgttcttaaaagaaaagatt
ggagtctatttcaaagaaaagcgtatacacatcaatttaaagtacatcgatccgagctac
ttgattcgttccgcggttgctgcgcccatagattcgatttactgcgaacgcctcggtaac
aatgcggtgcatgcggcgatgtgcggtaaaacgaaaatgatcattggcttggtgcacaat
aagtttgtacacctcccaatcgatgtggtggtgtgccaacgcaaacacgtaaatcctgaa
ggatcgttgtggcgcgacgcccttgatgcaacaggacagccgattgtgatgaaaaatatt
atctag

DBGET integrated database retrieval system