KEGG   Treponema pallidum subsp. pallidum Chicago: TPChic_0168Help
Entry
TPChic_0168       CDS       T01868                                 

Definition
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tph  Treponema pallidum subsp. pallidum Chicago
Pathway
Glycolysis / Gluconeogenesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:tph01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tph01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tph00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:tph00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
190229..190984
Genome map
AA seq 251 aa AA seqDB search
MKLVLIRHGESEWNRLNLFTGWTDVPLTPRGESEAQEGGRVLQEAGFDFDLCYTSFLKRA
IRTLNFVLQALDREWLPVHKSWKLNERHYGDLQGLNKTETAQKYGEQQVRVWRRSFDVAP
PPLTVGDARCPHTQASYRGVCASGRTPVLPFTESLKDTVARVVPYFEEEIKPQMISGQRV
LIVAHGNSLRALMKHIESLDETQIMEVNLPTGVPLVYEFEADFTLCGKRFLGNEADVAAR
AQAVADQGKSN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttgtgttgatccgtcatggagaaagtgaatggaacaggctgaacctgttcact
ggttggacagatgttccgcttaccccacgtggggagtcggaagcccaggaaggaggccgc
gtactgcaagaagcggggtttgattttgacctatgctacacttctttcttgaaacgtgcc
attcgtacgctcaattttgtactccaggcactggaccgtgagtggttgccggttcacaaa
agctggaaattgaacgagcggcattatggggatctacaaggtttaaataagacagagacg
gcgcagaagtatggtgagcagcaggttagggtgtggcgtcgctcctttgatgtggctcct
cctccgcttactgtaggggacgcacgttgtccgcatactcaagcctcctaccggggggta
tgcgcgtctggtcggacgccagtacttccgtttacggaaagtttgaaagataccgttgcg
cgtgtggtgccgtattttgaagaggaaatcaaaccgcagatgatttccggacagcgtgtg
cttattgtggcgcatggtaactcgttgcgcgcactgatgaagcacatagagtctttggat
gagactcagataatggaagtaaatttgcctaccggtgtaccgcttgtctatgagttcgag
gcggattttaccctgtgtgggaagcgttttttaggtaatgaggcggatgttgcagcgagg
gcgcaggctgtggctgatcagggtaagagtaactaa

DBGET integrated database retrieval system