KEGG   Treponema pallidum subsp. pallidum Chicago: TPChic_0168Help
Entry
TPChic_0168       CDS       T01868                                 

Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (phosphoglyceromutase) (pgam) (bpg-dependent pgam) (dpgm)
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tph  Treponema pallidum subsp. pallidum Chicago
Pathway
tph00010  Glycolysis / Gluconeogenesis
tph00680  Methane metabolism
tph01100  Metabolic pathways
tph01110  Biosynthesis of secondary metabolites
tph01120  Microbial metabolism in diverse environments
tph01130  Biosynthesis of antibiotics
tph01200  Carbon metabolism
tph01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tph00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TPChic_0168
  Energy metabolism
   00680 Methane metabolism
    TPChic_0168
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TPChic_0168
Enzymes [BR:tph01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     TPChic_0168
Membrane trafficking [BR:tph04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    TPChic_0168
Exosome [BR:tph04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   TPChic_0168
  Exosomal proteins of melanoma cells
   TPChic_0168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADD72319
Position
190229..190984
Genome map
AA seq 251 aa AA seqDB search
MKLVLIRHGESEWNRLNLFTGWTDVPLTPRGESEAQEGGRVLQEAGFDFDLCYTSFLKRA
IRTLNFVLQALDREWLPVHKSWKLNERHYGDLQGLNKTETAQKYGEQQVRVWRRSFDVAP
PPLTVGDARCPHTQASYRGVCASGRTPVLPFTESLKDTVARVVPYFEEEIKPQMISGQRV
LIVAHGNSLRALMKHIESLDETQIMEVNLPTGVPLVYEFEADFTLCGKRFLGNEADVAAR
AQAVADQGKSN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttgtgttgatccgtcatggagaaagtgaatggaacaggctgaacctgttcact
ggttggacagatgttccgcttaccccacgtggggagtcggaagcccaggaaggaggccgc
gtactgcaagaagcggggtttgattttgacctatgctacacttctttcttgaaacgtgcc
attcgtacgctcaattttgtactccaggcactggaccgtgagtggttgccggttcacaaa
agctggaaattgaacgagcggcattatggggatctacaaggtttaaataagacagagacg
gcgcagaagtatggtgagcagcaggttagggtgtggcgtcgctcctttgatgtggctcct
cctccgcttactgtaggggacgcacgttgtccgcatactcaagcctcctaccggggggta
tgcgcgtctggtcggacgccagtacttccgtttacggaaagtttgaaagataccgttgcg
cgtgtggtgccgtattttgaagaggaaatcaaaccgcagatgatttccggacagcgtgtg
cttattgtggcgcatggtaactcgttgcgcgcactgatgaagcacatagagtctttggat
gagactcagataatggaagtaaatttgcctaccggtgtaccgcttgtctatgagttcgag
gcggattttaccctgtgtgggaagcgttttttaggtaatgaggcggatgttgcagcgagg
gcgcaggctgtggctgatcagggtaagagtaactaa

DBGET integrated database retrieval system