KEGG   Treponema pallidum subsp. pallidum Chicago: TPChic_0168Help
Entry
TPChic_0168       CDS       T01868                                 

Definition
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tph  Treponema pallidum subsp. pallidum Chicago
Pathway
Glycolysis / Gluconeogenesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TPChic_0168
   01230 Biosynthesis of amino acids
    TPChic_0168
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TPChic_0168
  Energy metabolism
   00680 Methane metabolism
    TPChic_0168
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TPChic_0168
Enzymes [BR:tph01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     TPChic_0168
Exosome [BR:tph04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   TPChic_0168
  Exosomal proteins of melanoma cells
   TPChic_0168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
190229..190984
Genome map
AA seq 251 aa AA seqDB search
MKLVLIRHGESEWNRLNLFTGWTDVPLTPRGESEAQEGGRVLQEAGFDFDLCYTSFLKRA
IRTLNFVLQALDREWLPVHKSWKLNERHYGDLQGLNKTETAQKYGEQQVRVWRRSFDVAP
PPLTVGDARCPHTQASYRGVCASGRTPVLPFTESLKDTVARVVPYFEEEIKPQMISGQRV
LIVAHGNSLRALMKHIESLDETQIMEVNLPTGVPLVYEFEADFTLCGKRFLGNEADVAAR
AQAVADQGKSN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttgtgttgatccgtcatggagaaagtgaatggaacaggctgaacctgttcact
ggttggacagatgttccgcttaccccacgtggggagtcggaagcccaggaaggaggccgc
gtactgcaagaagcggggtttgattttgacctatgctacacttctttcttgaaacgtgcc
attcgtacgctcaattttgtactccaggcactggaccgtgagtggttgccggttcacaaa
agctggaaattgaacgagcggcattatggggatctacaaggtttaaataagacagagacg
gcgcagaagtatggtgagcagcaggttagggtgtggcgtcgctcctttgatgtggctcct
cctccgcttactgtaggggacgcacgttgtccgcatactcaagcctcctaccggggggta
tgcgcgtctggtcggacgccagtacttccgtttacggaaagtttgaaagataccgttgcg
cgtgtggtgccgtattttgaagaggaaatcaaaccgcagatgatttccggacagcgtgtg
cttattgtggcgcatggtaactcgttgcgcgcactgatgaagcacatagagtctttggat
gagactcagataatggaagtaaatttgcctaccggtgtaccgcttgtctatgagttcgag
gcggattttaccctgtgtgggaagcgttttttaggtaatgaggcggatgttgcagcgagg
gcgcaggctgtggctgatcagggtaagagtaactaa

DBGET integrated database retrieval system