KEGG   Treponema pallidum subsp. pallidum Chicago: TPChic_0609Help
Entry
TPChic_0609       CDS       T01868                                 

Gene name
asnS
Definition
asparaginyl-tRNA synthetase (EC:6.1.1.22)
Orthology
K01893  
asparaginyl-tRNA synthetase [EC:6.1.1.22]
Organism
tph  Treponema pallidum subsp. pallidum Chicago
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:tph00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
660697..662484
Genome map
AA seq 595 aa AA seqDB search
MSYGVVPVTEDRASAAPHLESKFPGNETTLFRTVRSPQSCAAFHADAAQGVRRGVTAACR
STPFHKEGKSVRVRAMHPLLKEILTHPPSGQHECVHGWVRSKRETKRAVFISLSDGSCPD
TLQVTVPLPECSASLSSGAQAEQIPNVRDAVLQGETLAQTLKRVTTGACIRAEGALVPSP
GAGQALELRACNLTVLGEAPAETYPLQKKSHSFEFLRAHAHLRARTSTFAACARVRSALA
GAVHRFFSERHFQYVHTPIITASDCEGAGELFRVTTFDPVRIAREAHAAGAAGNPYALTY
ADDFFGKAARLTVSGQLQGEAYALALTRIYTFGPTFRAENSNTSRHLSEFWMVEPEIAFA
RITDCMDVAEEFLAYLLRAALKDCAQDIAFLDERAAQHARSARGDTPLAARSTARTPPVR
TPGQLTRMLEDVARAPATRLTYTEAIKLLENSGRSFEFPVRWGCDLQSEHECFLTEEVFH
GPVIVYDYPKEIKAFYMKLNADGTTVRSMDLLVPGLGEIMGGSEREEQFEVLCARIRASG
FDPHDYRWYTDLRRFGTAPHAGFGLGFERLLQYVTGLGNIRDVIPFPRTPRTADF
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtacggcgtggtcccggtcacagaagaccgcgcctcggccgctcctcatctagag
agtaagttccctggaaatgaaacgacgctttttcgcacggttcgctctccccagtcctgc
gcggcgttccatgcagatgccgcgcagggcgtgcgccgtggcgtcacagctgcttgccgg
tccacgcccttccacaaagagggtaaaagcgttagagtgcgtgctatgcaccctttgctc
aaggagattctgactcatcccccctcaggccagcacgaatgcgttcacggttgggtgcgc
tccaaacgggagacaaaacgcgctgtctttatcagtctgagcgacggttcttgccctgat
acccttcaggttaccgttcccctgcccgagtgttccgcctccctttcctctggggcgcaa
gctgagcaaatccctaatgtccgcgacgctgtcctccagggggaaacgctcgctcaaacg
ctcaaacgcgttactaccggcgcctgcattcgcgccgagggtgcactcgtcccctcccca
ggcgccgggcaagcgcttgagttgcgcgcttgcaacctgactgttcttggcgaggcgcct
gctgaaacctatcctttgcagaagaaatcgcatagttttgagtttttgcgtgcgcacgcc
catctgcgcgcgcgcactagtacctttgccgcgtgtgcacgggtgcgcagtgcacttgca
ggcgctgtccaccgctttttctccgagcgacactttcagtacgtgcacacaccgatcatt
accgcttcggactgcgagggtgcaggcgagctctttcgcgtcactacttttgatcccgtg
cgtattgcgcgcgaagcacacgcagcgggcgcggcaggcaacccctacgcactcacgtac
gcggacgacttttttggtaaggcagcgcgcctaaccgtttcgggccaactgcagggggaa
gcatatgcgcttgccctcacgcgcatctacaccttcggccctacttttcgcgcagagaac
tcaaatactagccgccatctttctgagttctggatggtggagccggaaatcgcctttgca
cgcatcactgactgcatggacgtggcagaggagtttttggcgtacctgctacgcgcagca
ctcaaggactgcgcgcaggatatagccttccttgacgagcgcgcagcgcagcatgcgcga
agcgcgcggggcgacacaccccttgccgcgcgcagcacagcgcgcacaccgccagtgcgg
acgccagggcagctgacgcgcatgctcgaagacgtcgcccgcgcgcctgccacgcgcctg
acatacacagaggcaattaaactactggagaacagtgggcgctcctttgagttccccgta
cgctggggatgcgatttacaaagcgagcacgagtgttttttaacagaagaggtgttccac
ggcccggtgattgtctatgactacccaaaggaaatcaaggccttctacatgaagctcaat
gccgacggcacaacggtgcgttccatggacctgctagttccgggattaggggagattatg
ggaggctcggagcgcgaggaacagtttgaagtactctgtgctcgcatccgtgccagcggt
tttgaccctcacgactatcgctggtacaccgatctccgtcgctttggtaccgcgccccat
gcaggttttggactcggcttcgagcgcttgctgcagtacgtcaccgggcttgggaatatt
cgggatgttattccgtttcctcgtacgccgcgcactgcggacttttag

DBGET integrated database retrieval system