KEGG   Treponema pallidum subsp. pallidum Chicago: TPChic_0631Help
Entry
TPChic_0631       CDS       T01868                                 

Definition
chemotaxis response regulator protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
tph  Treponema pallidum subsp. pallidum Chicago
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:tph00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    TPChic_0631
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    TPChic_0631
Enzymes [BR:tph01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     TPChic_0631
Two-component system [BR:tph02022]
 CheA family
  CheA-CheYBV
   TPChic_0631
Bacterial motility proteins [BR:tph02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    TPChic_0631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
690097..691374
Genome map
AA seq 425 aa AA seqDB search
MNATRGKAAHQSVYRQGATDYRMKNTNDIAVLIVDDSALMRKVIGKVIEGAPGLSIAGKA
MNGRFALDMLERVQPDVILLDLEMPHMNGLQFLEQRKRLRIDIPVIILSSIAKEGARVTM
QCLELGASDFVTKPFGSESAHLRTVSRKIVDYVTAYGRRYKLLRRTRRCLAMDTPVERPA
GEEDLNCLDTQERASLPSVCARAPARDRASYTITPTEGARQTRIVPLRESGALQIIAIGV
STGGPSALRHIFAQLDADLPQPVVVVQHMPAGFTREFAYSLNQVCALEVKEAQEGDLVRR
GRVLIAPGDRHLTVERRSLATVAHINSDEPENGHRPSVDVLFESVARHFENRALGILMTG
MGRDGAAQLARLYTEGSRTIAQDADSCIVYGMPRVACELGAVGEQVSLDDMAATINRYGK
VFASS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccacgcgcggtaaggctgcacaccagagcgtatacaggcagggggccacagac
taccgtatgaaaaatactaatgatattgctgttttaatcgtggacgattctgcgctcatg
agaaaggttattggaaaagtcattgaaggagcgccgggtcttagcatagcgggcaaggcc
atgaatgggcgctttgcgcttgacatgctagagcgtgtacagccagatgtcatcttgctc
gacctggaaatgccgcacatgaacgggcttcagtttcttgaacagcggaaacgtctacgc
attgatattccagtaatcattctctctagcattgcaaaagaaggtgcacgggtcacgatg
caatgtttggagctgggggcaagtgactttgtcaccaagccttttggatctgagtctgcg
catttgcgcacggtttcgcgcaagattgtcgattacgttaccgcgtatgggagacgctac
aagttgctgcgccgcacgcgccgctgtcttgccatggacacacctgttgagagacctgcc
ggcgaggaggacttgaattgtttagatacccaagagcgagcctctctgccgtctgtatgt
gcacgtgcgcccgcgcgtgaccgtgcatcctacacaatcacccccacagagggagcgcgc
caaacgcgcatcgtgccactgcgtgaaagtggggcactgcagatcattgcaatcggcgta
tcaacgggaggacctagcgcgctgcgtcatatctttgcacagctcgatgcagatttgccg
cagccggtggtagtagtgcagcacatgcctgcaggtttcacgcgtgaatttgcgtacagt
cttaaccaggtatgtgcgctggaagtaaaagaagcgcaagaaggagacttggtgcggcgt
gggcgtgttttgattgcccccggggatcgccatctgacggtagagcggcgctccctggca
actgttgcgcacatcaactcggatgaaccggaaaacggtcaccgacccagcgttgatgtg
ttatttgagtcagtagctcgccattttgaaaaccgcgcattgggaattttaatgacagga
atgggaagggacggtgccgcgcagcttgcgcgtttatacacagaaggctcgcgtacaatt
gcgcaggacgcagattcgtgcattgtatatggaatgccgcgtgtagcctgcgaacttgga
gcagttggcgaacaggtgagtcttgatgatatggcagcgacaataaatcgctacggcaag
gtgtttgcctcttcctga

DBGET integrated database retrieval system