KEGG   Treponema pallidum subsp. pallidum Chicago: TPChic_0902Help
Entry
TPChic_0902       CDS       T01868                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
tph  Treponema pallidum subsp. pallidum Chicago
Brite
Enzymes [BR:tph01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     TPChic_0902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(985253..986107)
Genome map
AA seq 284 aa AA seqDB search
MTIQETRAVLAARFLFTFCCFFTTLARYLLMAEHTSCTSIHPLVRSAFYAGGAHAVLLIH
GYMGTPREMQFLGRALHRDGFTVSIPRLPGHGTNREDFLETGWRDWLRRVCDEYRDLSAA
YPSVSVGGLSMGGVLTALVAARFCPQKAFFCAPGFAVSDWRIKLSPLVRWFVREFAADAA
PFYPEQDFNDATKDYRSAHYIAQVAQFYALQRRAIRSLACIRSTLLTILSRQDPLVPCAA
VQKLLDARVRSAHQYVVLEHSGHVITDDVEREQVASCVSAFLRT
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
gtgacaatacaagagacgcgtgcggtgctcgcggcacggtttctctttactttttgttgc
ttttttactaccctcgcgcgctatctgcttatggctgaacatacttcctgtacgagcatt
catcctcttgtgcgcagcgcgttttacgccgggggtgcgcatgcagtactgcttattcat
gggtacatgggcaccccgcgcgagatgcagtttttaggtcgtgcgctccaccgggacggc
tttacggtctctattccccgtttacctggtcacggtacgaatagagaggattttcttgag
accgggtggagggattggctgcggcgcgtgtgtgatgagtaccgtgacctttccgctgcg
tacccttcggtatctgtgggggggctgtccatgggaggtgtgctgactgcactcgtggcg
gcgcgtttttgtccccagaaagctttcttttgtgcaccgggttttgcagtttctgattgg
aggataaagctgtctcctctagtcaggtggtttgtgcgtgagtttgctgcggacgcggct
cccttctaccccgagcaagactttaatgacgccacaaaggattaccggagtgcgcactac
attgcccaggtggcgcagttttacgcactgcaaagacgtgcgatccgttcgctggcgtgc
attcggagtacgttgttaacgatcctgtctcggcaggacccattggtgccgtgtgcagcg
gtgcaaaaattactcgatgcgcgtgtgcgcagcgcacaccagtacgtagtgctcgagcac
agtggtcacgtgatcactgatgacgtggagcgggagcaggttgcctcttgtgtcagtgct
tttttacgcacgtag

DBGET integrated database retrieval system