KEGG   Treponema primitia: TREPR_0157Help
Entry
TREPR_0157        CDS       T01507                                 

Definition
(GenBank) acyl-coenzyme A synthetase ACSM3
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tpi  Treponema primitia
Pathway
tpi00010  Glycolysis / Gluconeogenesis
tpi00620  Pyruvate metabolism
tpi00640  Propanoate metabolism
tpi00680  Methane metabolism
tpi01100  Metabolic pathways
tpi01110  Biosynthesis of secondary metabolites
tpi01120  Microbial metabolism in diverse environments
tpi01130  Biosynthesis of antibiotics
tpi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tpi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TREPR_0157
   00620 Pyruvate metabolism
    TREPR_0157
   00640 Propanoate metabolism
    TREPR_0157
  Energy metabolism
   00680 Methane metabolism
    TREPR_0157
Enzymes [BR:tpi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TREPR_0157
Lipid biosynthesis proteins [BR:tpi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TREPR_0157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEF85631
UniProt: F5YMG5
Position
119858..121570
Genome map
AA seq 570 aa AA seqDB search
MNEILSKYCPRIEFESYEDFYRNYTCRVPENFNFAYDVVDEWARIKPDKTALVWTNDAGD
MASFTFADMKRLSDKAANVLLAQGIVKGDVVMLILKQRPEVWVLMIALMKIGAVCIPGTY
QLTQKDIVYRCNIAEVKLLIHVDDPDLLKNIKGALPECTFLKKTAVVGTQIPEGCIDMRA
EIDKASAEFTRPTGSAGTQNTDHMLIYFSSGTTGMPKMVLHNYTLPLGHIVTAKYWQCVE
DDGIHLTQTDSGWAKFAWGKIYGQWICGAAIGAYDTEKFTPQGILAALGRLRPLTFCATA
TIFRFLIKEDLSGNDFSYIKHASVAGEPLSPEVYHKLKELTGMELREGFGQSETSVMAAT
FKWLPVKPGSMGKPSPLFGLNLLDENGKPCDDGIVGNISITNGGDNPPPGLFTGYWKDEE
ITRNCWYDGVYHTGDMAWHDGDGYYWFVGRNDDVIKCSGYRIGPFEVESALMEHPSVLEC
AVTAAPDPNRGQVVKATIVLARGFTGSDELKRELQNHVKRVTAPYKYPRIVEFVDELPKT
VSGKIQRNMIRKKDASEFPSSEPTQSPAKG
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagatactgtccaaatattgtccccggatagaatttgaaagctatgaggatttc
tatcggaattatacctgccgggtcccggaaaattttaacttcgcctacgatgtggttgat
gaatgggcgcggattaaaccggataagacggccctagtctggaccaacgatgcgggagat
atggcgtcctttacctttgctgatatgaagcgcctgagcgataaggccgccaatgtcctt
cttgcccagggcatcgtaaaaggtgatgtggtcatgctcatcctcaagcagcgccccgag
gtatgggtactgatgatcgccctgatgaagatcggcgcggtctgtatccccggcacctat
cagcttacccaaaaggatattgtataccgctgtaatattgccgaggttaagttactgata
catgtggacgatccggatctgcttaaaaacatcaagggcgctttgccggaatgtactttc
cttaaaaaaaccgccgtggtggggacccaaatcccagaaggttgtattgatatgcgggcg
gagatcgacaaggcctccgcagagtttacccgacccacaggttccgcagggacccaaaac
acggaccatatgctgatctacttttcctcgggaaccaccgggatgcccaagatggtactc
cacaactacacccttcccttggggcatatcgttactgccaagtactggcaatgcgtggag
gatgatgggatacatttgacccagaccgattcggggtgggccaaattcgcctggggcaag
atctacggtcagtggatctgcggcgcggccataggcgcctacgatacggagaagtttacc
ccccagggcatactcgccgctctgggccgtctgcgcccgcttaccttttgcgccaccgcc
acgattttccggttcctcatcaaggaggatctttcggggaatgattttagctatatcaaa
cacgcctccgttgccggagaacccctaagccccgaggtgtaccacaagcttaaggaactt
acgggcatggaacttagggaagggttcggccagtcggaaacttcggtaatggccgccaca
ttcaagtggctgccggtaaaacccggttccatggggaagccctcgccccttttcggcctc
aacctgctggacgaaaacggaaagccctgcgacgacggcatcgtcgggaatatcagtatt
actaacggcggggataatccgccgccgggattgtttaccggctattggaaggacgaggag
atcacccggaactgctggtacgacggggtctaccacaccggggacatggcctggcatgac
ggcgacggctactactggttcgtgggcaggaacgacgatgtgataaaatgctccgggtac
cgtatcgggccctttgaagtggaaagcgccctgatggaacacccctcggtgctggaatgc
gcggtcaccgccgctccggaccctaacaggggccaggtggttaaggccaccatcgtgtta
gcccggggctttaccgggtcggatgaactaaagcgggaactgcaaaaccatgtaaaacgg
gttactgctccctacaagtacccccggattgtggaatttgttgatgaactgccaaaaacc
gtcagcgggaagatccagcggaacatgatacggaagaaggatgcatcggaatttccctcg
tcggaacccacacagtctccggcaaagggttaa

DBGET integrated database retrieval system