KEGG   Treponema primitia: TREPR_0223Help
Entry
TREPR_0223        CDS       T01507                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
tpi  Treponema primitia
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tpi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(58517..60043)
Genome map
AA seq 508 aa AA seqDB search
MSTTAVSPAVQNQRAAGILLAVSSLPSRYGIGTFGQTARQWVDFLKEAGQKYWQILPLGT
TGWGDSPYQSFSAFALSSYYVDLDILRDQGLLTSEEIETLPWGQKPNRVYYAAQYFHREK
VLREAFARFRENSSARGDPAFTAFQEKHAHWLKDYSLFMALKRRSKGASWLDWEDALRFR
DEKTLSRFRDKLAGDIEYHSFVQYQAYTQWESLKAYANSNGVSIIGDIPIYVAMDSADTW
ANSDLFQLDEQRRPIRVAGCPPDPFSATGQLWGNPLYRWDLLEQSGFAWWISRLRACMAL
YDVTRIDHFRGFESYYSIPAADRDASGGEWVKGPGLSFINALNRELPGANIIAEDLGYLT
PEVRELLRASGYPGMKILQFAFDSRESSDYMPHTFERHCVVYTGTHDNPTTLGWMKTARF
EDVVLAREYLGLKDIREGHWAFIRAALSSVANLAVIPMQDYLGLGVNARMNTPSTTGGNN
WRWRLQSDALDSGLAKKIERLTRIYGRT
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacaacggctgtttcccctgcggttcagaaccaacgggccgcaggaatactgttg
gcggtgagcagtctgccctcccggtatggcatcgggacctttgggcagaccgcccggcaa
tgggtagattttctgaaagaggccgggcagaagtactggcagatcctgcctctgggaacc
accggttggggggacagtccctaccagagtttttccgcctttgccctgagcagctattat
gttgatttggatatactccgcgatcagggactgcttaccagtgaggagattgagacccta
ccttggggacaaaagccaaaccgggtgtattacgccgcccagtacttccaccgggagaag
gtgttgcgggaagcctttgcccggttcagggaaaattcttccgcacggggggatcccgcc
ttcaccgcgtttcaggagaaacacgcccactggctcaaggattacagcctcttcatggcc
ctgaaacgccgcagtaaaggcgcttcctggctggattgggaggatgcgctgcggttccgg
gacgagaaaaccctttcccgctttcgggacaaactcgccggggatatcgaataccattca
ttcgtacagtaccaggcctatacccagtgggaaagcctcaaagcctacgcgaacagtaac
ggtgtttcgatcatcggggacattcccatctacgttgccatggacagcgccgatacctgg
gcaaacagcgatctgttccagttggacgaacagcgcaggccaatccgggtcgccggctgc
cccccggatcccttttccgccaccgggcagctctggggaaaccccctgtaccgctgggac
ctgctggaacaaagcggctttgcctggtggatctcccggctccgcgcctgcatggccctc
tacgacgttacccgcatcgatcacttccggggttttgaaagctactattccattcccgcc
gccgacagggatgccagcgggggcgaatgggtaaaggggccggggctcagttttattaac
gccctgaaccgggaactgcccggggccaacatcattgctgaggacctgggctaccttacc
ccggaggtgcgggaactccttcgcgcttccggttaccccggcatgaagatactgcaattc
gccttcgactcacgggaatccagcgactatatgccccacacctttgaacgccactgcgtg
gtatacaccggcacccacgacaaccccaccaccctgggctggatgaaaaccgcccgcttc
gaggacgtggtcctggcaagggaatacctgggcctcaaggatatacgggaaggccactgg
gcttttatccgcgcagccctgtccagcgtcgccaacctggcggtcatccccatgcaggac
tatctgggcctgggcgtcaatgcccggatgaacacaccatccaccacagggggcaataac
tggcgctggcgattacagagtgatgccttggacagcgggctggcgaaaaagattgagcgg
cttacgcggatttacgggcggacatag

DBGET integrated database retrieval system