KEGG   Treponema primitia: TREPR_0240Help
Entry
TREPR_0240        CDS       T01507                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
tpi  Treponema primitia
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TREPR_0240
Enzymes [BR:tpi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     TREPR_0240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(39525..41555)
Genome map
AA seq 676 aa AA seqDB search
MAKTQKEQNAAGISTERLIGVAVPVGALRGEQSIGVGEFPDLVEFAELCITMGVELIQIL
PVNDTGYESSPYGSLTAFALNPLYLRIGDLGEAAGFTDKLIALKKQFDGETRFPYYKILR
AKIDLLREIFAANEKDITAKAKSGGSLATWIDKNPWVKEYAVYRRLKEINGEKSWKEWKT
HRTVNPEDIQVLWKDQKQQKEHLFWAWLQEALDTQFSKAAKALNKMGILLEGDLPILMNE
DSCDVWAHPEYFYPELSAGAPPDMYNSEGQNWGFPTYNWQAQAKDDYAWWRQRLSIAEKY
YNAYRIDHVLGFFRIWSSLRENNYDNAILGRYVPYSPITKKDLDELHFDEGRIRWISQPH
VPTSEVWGALNEIQDTGAAAKEAEKIFSQVLDRIGNEELWLFKKSIKGEQDITALGLHPA
PTAYLRKAWRNRLFLEYEKGKFFPVWLYRESRAYQSFSGDERNALDALLAKRLEESEKTW
ETQGKKLLSILVESSKMLPCAEDLGAVPDCVPKVLAKLKILGLRVIRWHREWDKPGQPYY
AFEDYPELSVCTPSVHDSSTLREWWDKEADQGQFSAFLGVPSLPKVYNPGTAKTILSHAA
AAASRFRVFQIQDLLHLSTKWYAEDPASERINVPGFVNEFNWTYRLPAAIKEIRKDEALI
KSIQELAAVTPKKKSR
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaacgcagaaagaacagaatgccgccggaatttccaccgaacgcctgattggc
gtggctgtcccggtgggggccctccggggagaacagagtattggggtgggggaattcccg
gatctggtggaattcgccgagctttgcataaccatgggggtggagctgatccagatcctg
ccggtaaacgatacggggtacgaaagctccccctacggctcattgaccgcctttgccctg
aatcccctctacctgagaatcggggatctgggagaagccgccggctttacggacaaactt
atcgccctgaaaaaacagttcgacggggaaacccggttcccttactacaagattctccgg
gcaaaaattgatctgctcagagaaatatttgcagctaacgaaaaagatattactgccaag
gctaagtccgggggctccctggccacctggattgataaaaatccctgggtaaaggaatat
gcggtgtaccgccggctcaaggaaattaacggggaaaagagctggaaggaatggaaaacc
caccggaccgttaaccctgaggatatccaggtgctctggaaggaccagaagcagcaaaaa
gaacacctgttctgggcctggctccaggaagccctggacacccagttcagcaaggccgcc
aaggccctgaacaagatggggatactcctggaaggggacctgcccattctgatgaacgag
gattcctgcgatgtctgggcccaccctgagtatttttacccggaactttccgccggggcc
cccccggatatgtacaattccgaaggccagaactggggcttccctacctacaactggcag
gcccaagccaaggacgattacgcctggtggcggcagcgcctgagtatcgcggaaaagtac
tacaacgcctaccgcattgaccatgtactgggctttttccgcatctggtcctccctgcgg
gaaaacaattacgataatgcaattctgggccgctatgtgccctattcgccgatcacgaaa
aaggacctggatgagcttcactttgacgaaggccggatacgctggatttcccagccccat
gtgcccaccagtgaagtctggggcgctctgaacgaaatacaggacacaggcgccgctgcc
aaggaagcggaaaaaatcttttcccaggttttggaccgtatcggcaatgaggagctctgg
cttttcaagaaatccatcaaaggggaacaggacataactgccctgggtctccacccggcg
ccgaccgcctatctccgcaaagcctggcggaaccggcttttcctggaatacgaaaagggc
aagttcttcccggtctggctttaccgggaatcccgggcttaccagtctttttccggggat
gaacgaaacgccctggatgcgctgctggcaaagcggctggaggaatctgaaaagacctgg
gaaacccaggggaaaaagcttctctccattctggttgaaagttccaagatgctgccctgc
gcggaggatctgggggcggtcccggactgcgttcccaaggtcttggcaaagctgaagata
ctggggctccgggttatccgctggcaccgggaatgggacaagccgggtcagccctattac
gcctttgaggattatcctgagctgagcgtatgcaccccctcggtccacgacagctccacc
ctgcgggaatggtgggacaaggaagcggaccaggggcaattcagcgcattcctgggggtt
ccctccctgcccaaggtctataatcccggaacagccaaaaccatcctgagccatgcggcg
gcggcggcctcccggttccgggtcttccagatccaggacctgctccacctttccaccaaa
tggtacgccgaggatcccgcgtctgaacggatcaacgtgcccggctttgtcaacgaattt
aactggacctaccgtcttccggcggccattaaggagatacggaaagacgaggctcttatc
aaatcaatacaggagttggccgcagttacgccgaaaaaaaagagcagatag

DBGET integrated database retrieval system