KEGG   Treponema primitia: TREPR_0256Help
Entry
TREPR_0256        CDS       T01507                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tpi  Treponema primitia
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tpi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TREPR_0256
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TREPR_0256
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TREPR_0256
Enzymes [BR:tpi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TREPR_0256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20160..21362
Genome map
AA seq 400 aa AA seqDB search
MKSSITGLICPKCHAHYDHRELQGLCRCGSPLLVEYDLISVGKKVNPDKLRHRPATLWRY
GELLPVLDESNIVSLGEGFTPLTLLPKITAKYDFGNLLMKDEGVIPTGTFKARGAAVGVS
KAKELGVTHVAMPTNGNAGAAWAVYAARAGISAHILMPEDAPRITRNESIAAGAEVYLVQ
GLISDCGKILARSIPAHGWYDVSTLKEPYRIEGKKTMGYEIVEQLGWQVPDVIAYPTGGG
VGIIGIYKALKEMQGLGWIGEKLPRLVAVQASGCAPIVEAYRKKAKESEFFPNSKTIAFG
INVPKALGDFLVLEALYETGGCAVAVEDREILESLAELASTEGAFVCPEGAAVLAALKRL
RAENWLKADETAVLLNTGAGIKYPDTLQFKLNYCPVDGTI
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagttctataactggactgatatgtcccaagtgtcacgcgcattatgatcaccgg
gaattgcagggcctttgccggtgcggttctcccctgctggtcgaatatgatctgatcagt
gtgggtaaaaaggtaaacccggacaaacttcggcaccgtcctgccacgctctggcgctat
ggagaactgttgccggttctggatgaaagcaatattgtgtccctgggcgaaggttttacg
ccccttaccctacttccaaaaattaccgctaaatatgattttggcaatctgcttatgaag
gacgaaggagtgatccctaccgggaccttcaaagcccggggcgcagcggtaggggtgtcc
aaggctaaagaattgggtgtgacccatgtagctatgccgactaacggtaacgccggagcc
gcctgggcagtatacgccgccagggctggtatttcggcccacatcctcatgcccgaggat
gcgccccggatcaccagaaatgaaagcatagccgccggggcagaagtgtaccttgtccag
gggcttatcagcgactgcggcaaaattctggcccggtccatccctgcccacggctggtat
gatgtcagtaccctcaaggagccttaccgtattgaaggcaaaaagaccatgggttatgaa
attgttgaacaattaggctggcaggttccggacgtcattgcctaccccacaggtggcggt
gtggggattatcgggatttataaggccttaaaggagatgcagggattgggctggatcggg
gagaaattgccccggctggtggcggtccaggcttccggctgcgctcccattgtggaggct
taccgtaaaaaggcaaaagaaagtgaatttttccccaattcaaagacaatcgccttcggc
attaacgttccaaaggcgctgggggattttttggtcctggaagccctgtatgaaaccggc
ggctgtgcggtcgcggtggaggatcgggaaatactggaatcccttgcggaactggcttcg
acggagggcgcctttgtctgtccggaaggcgcggcggttctggcggccttgaaaagacta
agggccgaaaactggctcaaggcggacgaaacggcggttttgctgaataccggcgcgggt
attaaatatcccgataccctgcaatttaaactaaactattgcccagtggatgggactatt
tga

DBGET integrated database retrieval system