KEGG   Treponema primitia: TREPR_0387Help
Entry
TREPR_0387        CDS       T01507                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tpi  Treponema primitia
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tpi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TREPR_0387 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TREPR_0387 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TREPR_0387 (trpB)
Enzymes [BR:tpi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TREPR_0387 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3956819..3958027)
Genome map
AA seq 402 aa AA seqDB search
MSNVQRSFQRKGRFGEYGGQYIPETLMNEIINLEKAYNHYKDDPDFVAELDGLLKNYAGR
PSMLYYAEKMSADLGGAKIYLKREDMNHTGSHKINNVLGQALLAKRMGKTRIIAETGAGQ
HGVAAATAAALLGLECEIFMGKEDTDRQRLNVYRMELLGAKVNAVTSGTQTLKDAVNETM
REWVGRVQDTHYVLGSVMGPHPFPTIVRDFQSVISKEARSQILEREGKLPAAVVACVGGG
SNAIGMFYNFIPDATVKLIGCEAAGHGVDTPKHAATIAKGSVGIFHGMKSYFCQNDEGQI
APVYSISAGLDYPGIGPEHAHLHDTGRAQYVPVSDEAAVSAFEYLARTEGIICAIESAHA
LAHARILAPQIGKDENIIICLSGRGDKDVSAIAKYRGETINE
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgtgcaacgaagtttccagcgcaaaggcagattcggcgaatacggcgggcag
tacattccggaaaccctgatgaacgagatcatcaacctggaaaaggcctacaatcactac
aaagacgatcccgactttgtagcggaactggatggcctgttgaaaaactatgcagggcga
ccgtccatgctttactacgcagaaaagatgagcgccgatctggggggagcaaagatctac
ctgaaacgggaagatatgaaccacaccggctcccacaagattaacaacgttctgggccag
gccttgttggcaaagcgtatgggcaaaacccggatcatcgccgaaaccggtgcgggtcag
catggggttgctgctgctactgcggccgccctcctgggcctggagtgtgaaattttcatg
ggcaaggaagacaccgataggcagcggcttaatgtgtaccgcatggaacttctgggcgcc
aaggtaaatgccgtcacctcgggtacacaaaccctgaaggatgcggtgaacgaaaccatg
cgtgaatgggtcggcagggtacaggacacccactatgtgctgggctccgtcatggggccc
catccctttcctactatagtgcgggacttccaaagcgttatcagcaaagaagcccggtcg
cagattcttgaacgagaaggaaagcttcccgcagcggttgttgcctgtgtgggtggcggg
agtaacgctatcggtatgttctataactttattcccgatgcaacagtaaaactaataggt
tgcgaagctgcaggacatggggtggataccccaaaacacgcggccaccatagccaagggg
agtgtaggaatattccacggcatgaagtcctacttctgccagaatgatgaggggcagata
gccccggtctattcgatttccgcagggctggactatccggggataggcccggaacacgcc
catcttcacgacacaggccgtgcccagtacgtgccggtcagcgacgaagcggctgtgtcc
gcctttgagtacctggcccgtactgaagggatcatctgcgccatagagagcgcccacgcc
ctggcccacgcaaggatattggcgccccaaatcggtaaggacgagaacatcatcatctgc
ctctctggccggggggacaaggacgtttcggcaatagcaaaatatcgcggggagactatc
aatgagtaa

DBGET integrated database retrieval system