KEGG   Treponema primitia: TREPR_0388Help
Entry
TREPR_0388        CDS       T01507                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tpi  Treponema primitia
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tpi01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:tpi00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:tpi00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3956029..3956826)
Genome map
AA seq 265 aa AA seqDB search
MSNINKAFQQKDPSGKPRSAFIGFLTGGDPSMEKSEEFVLEMIRAGADLVEIGVPFSDPI
AEGPVIQEANIRALSAGATVEKLFGLVKSLRSKTDVPLVFLTYLNPVFHYGYDPFFKRAR
DAGLDGIIIPDLPFEEQPEVRESASKYGVDIISLIAPTSEARIKEIAKAATGYIYLVSSM
GVTGVRSEIKTDLGSIIAALRETTKIPVAVGFGIHTPAQAAEIGKIADGVIVGSAIVKII
AEHGADAGNHVYEYVRRMKIAVAGE
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatattaacaaggcttttcagcagaaggacccttcagggaagccccggtctgcc
tttatcggttttttaaccggcggggatccaagcatggaaaaatcagaagagttcgtcctg
gaaatgatccgggccggggcggacctggtggaaatcggcgtccccttttcggaccccatt
gccgaaggtccggttatccaggaagccaatatccgcgccctgtccgccggggctaccgta
gaaaaactattcggcctggtaaaaagcctgcgctcaaaaactgatgtccccttggttttt
ctcacttacctgaacccggtattccattatggctatgaccctttctttaagcgggcccgg
gacgccggcctggacggcatcatcattcctgacctgccctttgaggaacagcctgaggtc
cgggaatccgcctctaaatacggtgtggatatcatctcccttatcgctcctacttctgag
gcgaggattaaggaaattgccaaagcggcaacaggttatatctacctggtgtcgtccatg
ggagtcaccggggtacggagtgaaattaagaccgacctgggttccattattgctgcgctc
cgggagaccacgaagataccggtcgcagtgggctttggcatccacactcctgcccaggct
gctgagattgggaagatcgccgatggggttatcgtggggagcgctattgttaagattatc
gcggaacatggcgccgatgcgggtaaccatgtctacgagtacgtgaggaggatgaaaatc
gccgttgccggggaatga

DBGET integrated database retrieval system