KEGG   Treponema primitia: TREPR_0421Help
Entry
TREPR_0421        CDS       T01507                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tpi  Treponema primitia
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tpi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TREPR_0421 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TREPR_0421 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TREPR_0421 (thrC)
Enzymes [BR:tpi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TREPR_0421 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3916669..3918033
Genome map
AA seq 454 aa AA seqDB search
MRYYSTRSRSDPVNFATAALTGLAPDGGLFIPEEIPVYSEKVKRSLGTMDFHDIAFETIT
PYVHPEIPASVLEDLVHSAYPFPAPLVPVGDRLVLELFHGPTAAFKDFGARFMARAFSYL
RRGEDKPLRILVATSGDTGGAVADGFYGVEGISVTVLYPKGRVTPLQERQIAGLGGNISA
LAVEGSFDDCQGLVKAALSDEGLKKRLTLSSANSINVARLIPQAVYYSAAAGKALAGKTD
PDGEATPRLPGKSASPGAAHGVKAGTPLTICVPSGNFGNLTAGLYALKMGAPIAGFIAAT
NINKAVPDYLDTGEYNARQSQATISNAMDVGAPSNFERMKSHWPLEELRRMIRGVHINDE
DTRKTIVAVHEANGYFLDPHGAVGWRAADILDKGSEPVKGPLAVLATAHPAKFAETVEPL
TGPVPAPASIQSALGRTVSARVIPAELSAFMDSL
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgcgctattacagcaccaggagccggtccgatccggttaactttgctactgcggcctta
acgggcctggctccggatggggggctcttcatacccgaagaaatccccgtgtattcagaa
aaggtaaagcgttccctggggaccatggatttccacgacatagcctttgaaaccatcacc
ccttatgtacacccggaaatacccgcctcggtgctggaagaccttgtccactccgcctac
ccctttcctgcccccctggttcctgtaggtgaccggctagtgctggaacttttccacggc
cccaccgccgcctttaaggacttcggcgcccgcttcatggcccgcgctttttcctacctt
cgtcgcggcgaagataagccgctacggatactggttgccacctccggcgataccgggggc
gcagtggccgacggcttctacggagtagagggcatctcagtaaccgtgctctaccccaaa
ggccgggtaacccctttgcaggaacggcagatcgccggccttggagggaacatcagcgcc
ctggcagtggaaggcagcttcgacgactgtcagggcttggtcaaagccgccctgagcgac
gaaggcctgaaaaaacggctaaccctttcctcagccaactcaatcaacgtagcccggctc
ataccccaggcagtctactacagcgccgccgccggaaaagccctggccggtaaaaccgac
cccgatggtgaagccaccccccggctgcccggcaaaagcgcctcccccggcgcggcccat
ggcgtcaaagccgggacgcccctcaccatttgtgtccccagcggcaacttcgggaacctc
accgcaggcctctacgccctgaaaatgggcgcccccatcgccggcttcattgccgccacc
aacatcaataaagctgtccccgattaccttgacaccggcgagtacaatgcccgtcaatcc
caagccaccatttccaacgccatggacgtaggcgcccccagcaactttgagcgcatgaaa
agccactggcccctggaagaactgcggcgcatgatccgcggcgtccatataaacgatgag
gacacccggaaaaccatagttgccgtccacgaagcaaacggctactttctcgatccccac
ggcgccgtaggctggcgggccgcagatatcctggacaaaggctcggagccagtcaaaggc
ccactagcggtactcgctaccgcccacccggcgaaattcgcagaaaccgtggaacccctg
accggccccgttcctgcgccggcgtccatacagagcgccctgggtcgcaccgtttctgcg
cgggtaataccggcagagctttcggcgtttatggacagcttgtag

DBGET integrated database retrieval system