KEGG   Treponema primitia: TREPR_0456Help
Entry
TREPR_0456        CDS       T01507                                 

Definition
hypothetical protein
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tpi  Treponema primitia
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tpi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TREPR_0456
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TREPR_0456
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TREPR_0456
Enzymes [BR:tpi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TREPR_0456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3882792..3884171)
Genome map
AA seq 459 aa AA seqDB search
MAKRIPTRLYLSEDEIPRNWYNLRADMKDKPDPILHPGTLQPATAADLEAVFCKESVKQE
LDETTRLIPIPEGLREFYQAYRPAPLIRAYFLEKALGTPAEIYYKHEGTNTSGSHKLNSA
AAQTYYAKEEGLTSLTTETGAGQWGSAMAMACAYYDIKLTVYMVKVSSEQKPYRKALIET
YGAELIPSPSNTTEAGRGILARNPNTGGSLGCAISEAVETAIKTDKCRYVLGSVMNHVLL
HQSIIGQEAKAALDKYGIKPDIIIGCAGGGSNLGGLIAPFMADKINGKSDTRFIAVEPAS
CPSFTRGRYAYDFGDTAKTTPLLRMCTLGNGFIPSSNHAGGLRYHGMNPILSKLYQDGYL
EARSQVQTDVFDAAVQFAKIEGILPAPESSHAIKAAIDEALECKRTGEKKVILFGLTGTG
YFDMTAYMSYNAKTMTDSIPTDEDLAKGFASLPDIPQNK
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagaatccctacccgcttgtacctttctgaggacgagatccccaggaactgg
tacaacctccgggcggatatgaaggataaaccggaccccatcctgcaccccgggaccctg
cagcccgccacagcggcagatttggaagcggtgttttgcaaggagtcagtaaagcaggaa
ttggacgaaaccacccggcttattcccatccccgaggggcttcgggaattttaccaggcc
taccgtcccgccccgttgatccgggcctactttctggaaaaggccctgggaaccccggcg
gagatctattacaagcacgagggcaccaacacttccggctcccacaagctgaattccgcc
gccgcccagacctattacgccaaggaagaggggctcacatccctgaccaccgaaaccggg
gcgggccaatggggaagcgccatggccatggcctgcgcttattacgatattaagctcacg
gtttatatggtgaaggtcagttccgagcagaaaccctaccgaaaagccctgatcgagacc
tacggcgccgagctgattccctcaccgtcaaacaccaccgaagcgggcaggggcatcttg
gcaaggaaccccaacaccggcggctccctgggctgcgctatttccgaagccgtggagact
gcgataaaaaccgataagtgccgctatgtgctggggagtgtcatgaaccatgtgctgctt
caccagtccatcatcggccaggaggccaaggccgccctggacaaatacggcattaagccg
gacatcatcatcggctgcgcaggcggcggctccaacctggggggcctcattgcccccttc
atggcggataagatcaatggcaagtccgatacccggttcatagccgtggagcccgcttcc
tgtccctcctttacccggggccgctatgcctacgactttggggacactgccaagaccacc
ccgcttttacggatgtgtaccctggggaacggcttcatcccctcctccaaccacgccggg
ggcctgcgctaccacggcatgaaccccatcctgtcaaagctctaccaggacggatacctg
gaagcccgttcccaggtgcagaccgatgttttcgatgccgccgtgcagttcgccaaaatc
gaaggcatacttcccgcgccggaatcctcccacgccattaaggctgccatcgacgaagcc
ctggaatgtaagcggaccggtgaaaagaaggtgatcctcttcggccttaccgggaccggc
tactttgacatgaccgcctatatgtcctacaacgccaaaaccatgaccgactcgatcccc
actgacgaggatctggcgaagggttttgcaagtttgccggatataccgcagaataagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system