KEGG   Treponema primitia: TREPR_0456Help
Entry
TREPR_0456        CDS       T01507                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tpi  Treponema primitia
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tpi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TREPR_0456
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TREPR_0456
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TREPR_0456
Enzymes [BR:tpi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TREPR_0456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3882792..3884171)
Genome map
AA seq 459 aa AA seqDB search
MAKRIPTRLYLSEDEIPRNWYNLRADMKDKPDPILHPGTLQPATAADLEAVFCKESVKQE
LDETTRLIPIPEGLREFYQAYRPAPLIRAYFLEKALGTPAEIYYKHEGTNTSGSHKLNSA
AAQTYYAKEEGLTSLTTETGAGQWGSAMAMACAYYDIKLTVYMVKVSSEQKPYRKALIET
YGAELIPSPSNTTEAGRGILARNPNTGGSLGCAISEAVETAIKTDKCRYVLGSVMNHVLL
HQSIIGQEAKAALDKYGIKPDIIIGCAGGGSNLGGLIAPFMADKINGKSDTRFIAVEPAS
CPSFTRGRYAYDFGDTAKTTPLLRMCTLGNGFIPSSNHAGGLRYHGMNPILSKLYQDGYL
EARSQVQTDVFDAAVQFAKIEGILPAPESSHAIKAAIDEALECKRTGEKKVILFGLTGTG
YFDMTAYMSYNAKTMTDSIPTDEDLAKGFASLPDIPQNK
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagaatccctacccgcttgtacctttctgaggacgagatccccaggaactgg
tacaacctccgggcggatatgaaggataaaccggaccccatcctgcaccccgggaccctg
cagcccgccacagcggcagatttggaagcggtgttttgcaaggagtcagtaaagcaggaa
ttggacgaaaccacccggcttattcccatccccgaggggcttcgggaattttaccaggcc
taccgtcccgccccgttgatccgggcctactttctggaaaaggccctgggaaccccggcg
gagatctattacaagcacgagggcaccaacacttccggctcccacaagctgaattccgcc
gccgcccagacctattacgccaaggaagaggggctcacatccctgaccaccgaaaccggg
gcgggccaatggggaagcgccatggccatggcctgcgcttattacgatattaagctcacg
gtttatatggtgaaggtcagttccgagcagaaaccctaccgaaaagccctgatcgagacc
tacggcgccgagctgattccctcaccgtcaaacaccaccgaagcgggcaggggcatcttg
gcaaggaaccccaacaccggcggctccctgggctgcgctatttccgaagccgtggagact
gcgataaaaaccgataagtgccgctatgtgctggggagtgtcatgaaccatgtgctgctt
caccagtccatcatcggccaggaggccaaggccgccctggacaaatacggcattaagccg
gacatcatcatcggctgcgcaggcggcggctccaacctggggggcctcattgcccccttc
atggcggataagatcaatggcaagtccgatacccggttcatagccgtggagcccgcttcc
tgtccctcctttacccggggccgctatgcctacgactttggggacactgccaagaccacc
ccgcttttacggatgtgtaccctggggaacggcttcatcccctcctccaaccacgccggg
ggcctgcgctaccacggcatgaaccccatcctgtcaaagctctaccaggacggatacctg
gaagcccgttcccaggtgcagaccgatgttttcgatgccgccgtgcagttcgccaaaatc
gaaggcatacttcccgcgccggaatcctcccacgccattaaggctgccatcgacgaagcc
ctggaatgtaagcggaccggtgaaaagaaggtgatcctcttcggccttaccgggaccggc
tactttgacatgaccgcctatatgtcctacaacgccaaaaccatgaccgactcgatcccc
actgacgaggatctggcgaagggttttgcaagtttgccggatataccgcagaataagtga

DBGET integrated database retrieval system