KEGG   Treponema primitia: TREPR_0470Help
Entry
TREPR_0470        CDS       T01507                                 

Definition
beta-glucosidase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
tpi  Treponema primitia
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:tpi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TREPR_0470
Enzymes [BR:tpi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     TREPR_0470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3867885..3869324)
Genome map
AA seq 479 aa AA seqDB search
MKKEFPENFLWGGAIAANQCEGAYQEGGKGLSIADVLPSGKDRLELLTKGKGIPEIDTEK
YRYPNHEGIDFYHRYPEDIKLFAEMGFKCLRFSVNWSRIFPRGDEIEPNEAGLAFYDKVI
ETLLEYHIEPVLTISHYEMPLHLAKEYGGWKNRQLIDFFGRYCEVLFHRYRKQVKYWITF
NEINSAFMIPYMSLGCFIPTPEDRDKVLFQGLHHQFVASSRAVKRCHEIIPGSQVGCMIL
CAPVYPYSCDPQDVWKAHQEERLMNYFCADVQVRGAYPSYGLRYMAERGVEPKTESADLE
TMAKYPVDYLSFSYYMSRTEKADQGDVSAVTGNIIGGVKNPHLAHSEWGWEIDPLGLRIL
LNRLYDRYRVPLFIVENGLGAQDTVVGDGSIHDDYRIAYLRDHLAAARDALDDGVDLIGY
TSWGCIDLVSASTGEYRKRYGFIYVDKQDDGTGTLERKKKDSFYWYQNVIATQGRNLTD
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagaatttccggaaaattttctttgggggggcgccattgcggcgaaccaatgc
gaaggggcttatcaagaagggggcaagggtctttcgattgccgatgtcctgccatcgggc
aaggaccgcctggaattgttgaccaagggaaagggtatcccggaaatcgataccgaaaag
tatcggtatcccaaccatgagggtattgatttttatcaccgctacccggaggatatcaag
ctctttgccgaaatgggctttaagtgcctgcgtttttccgtaaactggagccggatattt
ccccggggagacgaaatcgaacccaacgaagcgggcctggccttctacgataaggtaatt
gagactttactggaatatcacattgaacctgtactcaccatttctcattatgaaatgccc
ctgcatctggctaaagaatacgggggctggaaaaaccggcaattgattgatttttttggc
agatactgtgaagtgcttttccatcgttaccggaagcaagttaaatactggatcactttt
aatgaaattaacagcgcctttatgattccctatatgagcctgggttgttttatccccact
cccgaagaccgggacaaggttcttttccaagggctgcatcaccaatttgtagccagcagc
cgggcagttaaacgctgccacgaaattatccccggttcccaagtgggctgcatgatcctc
tgcgccccggtatacccctattcctgcgatccccaggatgtgtggaaagcccaccaggag
gaacggcttatgaattatttctgcgccgatgtccaggtccggggcgcctacccttcttat
ggactccgctacatggcggaacgtggggtggaaccgaaaaccgaaagcgccgatctggaa
accatggcaaagtatcccgtagattatcttagttttagttattacatgtcccggaccgaa
aaggcggatcagggagatgtatcagccgtcacgggtaatatcatcggcggggtaaaaaac
ccccatcttgcccacagcgagtggggctgggaaattgatcccctgggtctgcggatactc
ctgaaccgcctctatgaccgctaccgtgttcccctatttatcgtagaaaacggcctgggc
gcccaggataccgtagtcggcgatggcagcatccacgatgactaccggatcgcctatttg
cgggatcaccttgccgccgcccgggatgcactggacgatggggtcgatttaatcggctat
accagttggggatgtatcgatctggtaagcgcttccaccggggaataccgtaagcgctac
gggtttatctatgtggacaaacaggatgacggaaccggcacactggaacggaagaaaaag
gattccttttactggtatcagaatgttatcgccacccagggccgaaatttgaccgattaa

DBGET integrated database retrieval system