KEGG   Treponema primitia: TREPR_1170Help
Entry
TREPR_1170        CDS       T01507                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
tpi  Treponema primitia
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tpi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TREPR_1170
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    TREPR_1170
Enzymes [BR:tpi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     TREPR_1170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3149405..3150583
Genome map
AA seq 392 aa AA seqDB search
MKPLPLLLLLYTLGTAPLCRALELGAGGGMEGQRRERAAGIAAAMDEKALAAQVLLTGLD
GNGSLGTAMTDLLRDISPGGVMLFRMNLNMNKERIPAFLKTVSDLAALNTPLSRGAGNIR
IPPFMAVDHEGGQIHRFVAGVERLPSPLSYWEAARTRDRNTVLRAIEEDAARSGRELRSL
GITMNLAPVAELLDGENVTFLEDRSYGPDAAFVEEAAAAFIRGMASSGVACVAKHFPGNS
GTDPHRAGAVLTEDREALNRRVRPFRGIITRESPAGIMVSHTIVNARQPGIQASRSPAVI
QTWLRGELGFSGLVLGDDFSMGAISAAGLTEEAAVVEALIAGVDMVMTWPRSLSRVHRAI
LRALQEGRLSRERLEEAATRIIYEKICFGLMD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccctgcccctgctgctgttgctctataccctgggaaccgcccctctttgccgg
gccctggaattgggggcaggtggcggcatggagggacagcgccgggaacgggcggcgggg
atcgcggcggccatggatgaaaaggccctggcggcacaggtactgctcaccgggctggac
gggaacggctccctggggacggccatgacagacctgctccgggatatatcccccggcggg
gttatgctgttccggatgaaccttaacatgaacaaggagcgcatcccggcttttctcaaa
accgtttcggatctggcggctttgaacacaccgcttagccggggcgccgggaatatccgg
atcccccccttcatggcggtggatcacgaaggggggcaaatccaccgttttgtcgccggg
gtggaacggctgccttcaccgttgagttattgggaggcggcccggacaagggacagaaac
actgttctcagggcgatcgaagaagacgccgcccggtcgggccgggagctgcgttccctg
gggatcacgatgaaccttgccccggtagcggaactgctggatggggaaaatgttacgttc
ctggaagaccgctcctatgggccggatgccgcctttgtcgaggaagccgccgccgccttt
atccggggcatggcttcctccggggtagcctgcgtggcaaagcacttccccggaaattcc
gggaccgacccccaccgggcaggggcggtgctgaccgaggacagggaggccctgaaccgc
agggtccggccctttagggggatcataacccgggaaagcccggcggggatcatggtttcc
cacactatcgttaacgcccggcagccgggcatacaggccagtcgttcgccagcggtgata
caaacctggctccggggggaactggggttttcaggcctggtcctgggggacgatttttcc
atgggggcgatcagcgccgccgggttaacggaggaagcggcggtagtggaagcgcttatc
gccggggtagatatggtgatgacctggccccggagcctcagccgcgttcaccgggcaata
ctccgggcactgcaggaaggacggctttcccgggagcggcttgaagaagcggcaacccgg
atcatatatgaaaaaatctgctttggattaatggattaa

DBGET integrated database retrieval system